Q6DN03 H2B2C_HUMAN
Gene name: H2BC20P
Protein name: Putative histone H2B type 2-C
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- chromosome organization GO:0051276
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q6DRA6 | H2BC19P | 0.99216 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
2 | Q16778 | H2BC21 | 0.89403 | cellular component assembly GO:0022607 chromosome organization GO:0051276 immune system process GO:0002376 ... |
3 | O60814 | H2BC12 | 0.8894 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
4 | P62807 | H2BC4 | 0.88758 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
5 | Q93079 | H2BC9 | 0.88127 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
6 | P23527 | H2BC17 | 0.88048 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
7 | Q5QNW6 | H2BC18 | 0.85708 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
8 | O00479 | HMGN4 | 0.85353 | |
9 | P57053 | H2BS1 | 0.85104 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 chromosome organization GO:0051276 ... |
10 | P33778 | H2BC3 | 0.84763 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
20 40 60 80 100 AA: MPEPAKFAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKRVHPDTGIWCKAMGIMNSFLNDIFERIAGEASRLAHYNKRSTITSRRSRRPCA STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................DDDD............ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... RICH_[AK]: AKfApApKKgsKKAvtKAqKK RICH_[AP]: PePAkfAPAPkkgskkA RICH_[K]: KfapapKKgsKKavtKaqKKdgKKrK RICH_[KP]: PePaKfaPaPKKgsKKavtK RICH_[KR]: KdgKKRKRsR RICH_fLPS_[K]: KKgsKKavtKaqKKdgKKrK RICH_MOBI_[AK]: AKfApApKKgsKKAvtKAqKK RICH_MOBI_[AP]: PePAkfAPAP RICH_MOBI_[K]: KfapapKKgsKKavtKaqKKdgKKrK RICH_fLPS_MOBI_[K]: KKgsKKavtKaqKKdgKKrK
120 140 160 180 AA: CCCPASWPSTPCPRAPRRSPSTPAPSESLPGPGARSLPPSLPPRVAGCFVSKGSFQGHLTTSVKESFLCCQSQLMFLASRLVNFRRAHNTKHR STMI: DO_DISOPRED3: ........................DDD............................................................DDDDDD DO_IUPRED2A: ............DDDDDDDDDDDDDDDDDDDDDDDDD..................................................DDDDDD DO_SPOTD: .......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D.....................................DDDDDDDDD CONSENSUS: ............DDDDDDDDDDDDDDDDDDDDDDDDD..................................................DDDDDD CONSENSUS_MOBI: ..........DDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... RICH_[P]: PraPrrsPstPaPseslPgP RICH_MOBI_[PR]: PcPRaPRRsP RICH_MOBI_[P]: PcPraPrrsPstPaPseslPgP