O00479 HMGN4_HUMAN

Gene name: HMGN4
Protein name: High mobility group nucleosome-binding domain-containing protein 4

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P05204 HMGN2 0.91225 immune system process GO:0002376
2 P07305 H1-0 0.85859 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
3 Q6DRA6 H2BC19P 0.85373 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
4 Q6DN03 H2BC20P 0.85353 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
5 O60814 H2BC12 0.85059 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
6 Q16778 H2BC21 0.84828 cellular component assembly GO:0022607
chromosome organization GO:0051276
immune system process GO:0002376
...
7 P62807 H2BC4 0.84754 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
8 P23527 H2BC17 0.83956 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
9 Q93079 H2BC9 0.83906 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
10 P33778 H2BC3 0.83581 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...

                                           20                  40                  60                  80          
AA:                      MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK
STMI:                                                                                                              
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PR]:                                   PqRRsaRlsakPaPPkPePRP                                                 
RICH_[AG]:                                                          AsAkkGeklpkGrkGkAdAG                           
RICH_[AK]:                    AKgdAKgdKAKvKdepqrrsArlsAKpA         KAsAKKgeKlpKgrKgKAdA                            
RICH_[AP]:                                        ArlsAkPAPPkPePrPkkAsA                                            
RICH_[K]:                  KrKaKgdaKgdKaKvKdepqrrsarlsaK    KpeprpKKasaKKgeKlpKgrKgKadagKdgnnpaK                   
RICH_[P]:                                    PqrrsarlsakPaPPkPePrP                                                 
RICH_[R]:                                      RRsaRlsakpappkpepR                                                  
RICH_[DK]:                   KaKgDaKgDKaKvKD                                                                       
RICH_[DN]:                                                                           DagkDgNNpakNrD                
RICH_[GK]:                                                             KKGeKlpKGrKGKadaGKdGnnpaK                   
RICH_[KP]:                                             KPaPPKPePrPKKasaKKgeKlPK                                    
RICH_fLPS_[P]:                                          PaPPkPePrP                                                 
RICH_fLPS_[K]:           mpKrKaKgdaKgdKaKvKde          KpappKpeprpKKasaKKgeKlpKgrKgKadagK                          
RICH_MOBI_[PR]:                              PqRRsaRlsakPaPPkPePRP                                                 
RICH_MOBI_[AG]:                                                     AsAkkGeklpkGrkGkAdAG                           
RICH_MOBI_[AK]:               AKgdAKgdKAKvKdepqrrsArlsAKpA         KAsAKKgeKlpKgrKgKAdA                            
RICH_MOBI_[AP]:                                   ArlsAkPAPPkPePrPkkAsA                                            
RICH_MOBI_[K]:             KrKaKgdaKgdKaKvKdepqrrsarlsaK    KpeprpKKasaKKgeKlpKgrKgKadagKdgnnpaK                   
RICH_MOBI_[P]:                               PqrrsarlsakPaPPkPePrP                                                 
RICH_MOBI_[R]:                                 RRsaRlsakpappkpepR                                                  
RICH_MOBI_[DK]:              KaKgDaKgDKaKvKD                                                                       
RICH_MOBI_[DN]:                                                                      DagkDgNNpakNrD                
RICH_MOBI_[GK]:                                                        KKGeKlpKGrKGKadaGKdGnnpaK                   
RICH_MOBI_[KP]:                                        KPaPPKPePrPKKasaKKgeK                                       
RICH_fLPS_MOBI_[P]:                                     PaPPkPePrP                                                 
RICH_fLPS_MOBI_[K]:      mpKrKaKgdaKgdKaKvKde          KpappKpeprpKKasaKKgeKlpKgrKgKadagK