P06899 H2B1J_HUMAN
Gene name: H2BC11
Protein name: Histone H2B type 1-J
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- immune system process GO:0002376
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P54577 | YARS1 | 0.83223 | biosynthetic process GO:0009058 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
| 2 | Q9BZE7 | C22orf23 | 0.82977 | |
| 3 | P21741 | MDK | 0.80558 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 4 | O95433 | AHSA1 | 0.77769 | biological process involved in symbiotic interaction GO:0044403 protein folding GO:0006457 |
| 5 | Q8TC29 | ENKUR | 0.75893 | |
| 6 | Q16778 | H2BC21 | 0.75715 | cellular component assembly GO:0022607 chromosome organization GO:0051276 immune system process GO:0002376 ... |
| 7 | Q5TBB1 | RNASEH2B | 0.75535 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell cycle GO:0007049 ... |
| 8 | Q8IXQ5 | KLHL7 | 0.75156 | cellular protein modification process GO:0006464 |
| 9 | O95760 | IL33 | 0.7446 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 10 | Q93079 | H2BC9 | 0.73983 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
20 40 60 80 100 AA: MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................DDDDDDD.D.......... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[AK]: AKsApApKKgsKKAvtKAqKK RICH_[AP]: PePAksAPAPkkgskkA RICH_[K]: KsapapKKgsKKavtKaqKKdgKKrK RICH_[KP]: PePaKsaPaPKKgsKKavtK RICH_[KR]: KdgKKRKRsR RICH_fLPS_[K]: KKgsKKavtKaqKKdgKKrK
120 AA: LLLPGELAKHAVSEGTKAVTKYTSAK STMI: DO_DISOPRED3: .........................D DO_IUPRED2A: .......................... DO_SPOTD: .................DDDDDDDDD CONSENSUS: .........................D CONSENSUS_MOBI: ..........................