Q93079 H2B1H_HUMAN
Gene name: H2BC9
Protein name: Histone H2B type 1-H
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | P23527 | H2BC17 | 0.9999 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
2 | Q16778 | H2BC21 | 0.98587 | cellular component assembly GO:0022607 chromosome organization GO:0051276 immune system process GO:0002376 ... |
3 | P57053 | H2BS1 | 0.98445 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 chromosome organization GO:0051276 ... |
4 | O60814 | H2BC12 | 0.98332 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
5 | P62807 | H2BC4 | 0.97867 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
6 | Q5QNW6 | H2BC18 | 0.97331 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
7 | Q99877 | H2BC15 | 0.95387 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
8 | Q8N257 | H2BU1 | 0.94135 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
9 | P33778 | H2BC3 | 0.93979 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
10 | P07305 | H1-0 | 0.92574 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
20 40 60 80 100 AA: MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................DDDDDDDDD.......... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ RICH_[AK]: AKsApApKKgsKKAvtKAqKK RICH_[AP]: PdPAksAPAPkkgskkA RICH_[K]: KsapapKKgsKKavtKaqKKdgKKrK RICH_[KP]: PdPaKsaPaPKKgsKKavtK RICH_[KR]: KdgKKRKRsR RICH_fLPS_[K]: KKgsKKavtKaqKKdgKKrK RICH_MOBI_[AK]: AKsApApKKgsKKAvtKAqKK RICH_MOBI_[AP]: PdPAksAPAP RICH_MOBI_[K]: KsapapKKgsKKavtKaqKKdgKKrKrsrK RICH_MOBI_[KR]: KdgKKRKRsRK RICH_fLPS_MOBI_[K]: KKgsKKavtKaqKKdgKKrKrsrK
120 AA: LLLPGELAKHAVSEGTKAVTKYTSSK STMI: DO_DISOPRED3: .........................D DO_IUPRED2A: .................DDD..DD.. DO_SPOTD: ...............DDDDDDDDDDD CONSENSUS: .................DDDDDDDDD CONSENSUS_MOBI: ..........................