Q93079 H2B1H_HUMAN

Gene name: H2BC9
Protein name: Histone H2B type 1-H

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P23527 H2BC17 0.9999 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
2 Q16778 H2BC21 0.98587 cellular component assembly GO:0022607
chromosome organization GO:0051276
immune system process GO:0002376
...
3 P57053 H2BS1 0.98445 anatomical structure development GO:0048856
cellular component assembly GO:0022607
chromosome organization GO:0051276
...
4 O60814 H2BC12 0.98332 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
5 P62807 H2BC4 0.97867 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
6 Q5QNW6 H2BC18 0.97331 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
7 Q99877 H2BC15 0.95387 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
8 Q8N257 H2BU1 0.94135 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
9 P33778 H2BC3 0.93979 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
10 P07305 H1-0 0.92574 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...

                                           20                  40                  60                  80                 100
AA:                      MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................DDDDDDDDD..........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................
RICH_[AK]:                   AKsApApKKgsKKAvtKAqKK                                                                           
RICH_[AP]:                PdPAksAPAPkkgskkA                                                                                  
RICH_[K]:                     KsapapKKgsKKavtKaqKKdgKKrK                                                                     
RICH_[KP]:                PdPaKsaPaPKKgsKKavtK                                                                               
RICH_[KR]:                                       KdgKKRKRsR                                                                  
RICH_fLPS_[K]:                      KKgsKKavtKaqKKdgKKrK                                                                     
RICH_MOBI_[AK]:              AKsApApKKgsKKAvtKAqKK                                                                           
RICH_MOBI_[AP]:           PdPAksAPAP                                                                                         
RICH_MOBI_[K]:                KsapapKKgsKKavtKaqKKdgKKrKrsrK                                                                 
RICH_MOBI_[KR]:                                  KdgKKRKRsRK                                                                 
RICH_fLPS_MOBI_[K]:                 KKgsKKavtKaqKKdgKKrKrsrK                                                                 

                                          120              
AA:                      LLLPGELAKHAVSEGTKAVTKYTSSK
STMI:                                              
DO_DISOPRED3:            .........................D
DO_IUPRED2A:             .................DDD..DD..
DO_SPOTD:                ...............DDDDDDDDDDD
CONSENSUS:               .................DDDDDDDDD
CONSENSUS_MOBI:          ..........................