P07919 QCR6_HUMAN
Gene name: UQCRH
Protein name: Cytochrome b-c1 complex subunit 6, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- generation of precursor metabolites and energy GO:0006091
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8NEV9 | IL27 | 0.83844 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 2 | Q9H2J4 | PDCL3 | 0.83205 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 3 | Q9BTA0 | FAM167B | 0.83205 | |
| 4 | Q86XI2 | NCAPG2 | 0.8 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 5 | Q8NBI5 | SLC43A3 | 0.78509 | |
| 6 | Q07817 | BCL2L1 | 0.78087 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
| 7 | Q9Y4A0 | JRKL | 0.76139 | anatomical structure development GO:0048856 |
| 8 | Q96I82 | KAZALD1 | 0.75569 | anatomical structure development GO:0048856 cell differentiation GO:0030154 extracellular matrix organization GO:0030198 ... |
| 9 | P24385 | CCND1 | 0.74038 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 10 | Q9Y3F4 | STRAP | 0.73106 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
20 40 60 80 AA: MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK STMI: TTTTTTTTTTTTT DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................D................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. CONSENSUS: DDDDDDDDDDDDD................................................................. CONSENSUS_MOBI: DDDD.......................................................................... RICH_fLPS_[E]: pEEEEEEEEE