Q9H2J4 PDCL3_HUMAN
Gene name: PDCL3
Protein name: Phosducin-like protein 3
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- catabolic process GO:0009056
- cell death GO:0008219
- cell population proliferation GO:0008283
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- protein folding GO:0006457
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y2Z0 | SUGT1 | 0.83205 | biological process involved in symbiotic interaction GO:0044403 cell cycle GO:0007049 mitotic cell cycle GO:0000278 |
| 2 | Q96P20 | NLRP3 | 0.83205 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 3 | Q8NEV9 | IL27 | 0.69763 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 4 | Q9BTA0 | FAM167B | 0.69231 | |
| 5 | Q13049 | TRIM32 | 0.69231 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 6 | Q86XI2 | NCAPG2 | 0.66564 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 7 | Q8NBI5 | SLC43A3 | 0.65324 | |
| 8 | Q07817 | BCL2L1 | 0.64972 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
| 9 | Q9Y4A0 | JRKL | 0.63351 | anatomical structure development GO:0048856 |
| 10 | P42857 | NSG1 | 0.62877 | cell death GO:0008219 cell-cell signaling GO:0007267 cellular component assembly GO:0022607 ... |
20 40 60 80 100 AA: MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERAIEMYRRRRLAEWKATKLKNKFGEVLEISGK STMI: DO_DISOPRED3: DD.........................DDD.....D................................................................ DO_IUPRED2A: DDDDDDDDD.DDDDD.........DDDDDDDDDD.....D..........DD...DDDDDDDDDD.DD................................ DO_SPOTD: DDDDDD................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................... CONSENSUS: DDDDDD..................DDDDDDDDDDDDDDDD..........DDDDDDDDDDDDDD.................................... CONSENSUS_MOBI: .................................................................................................... RICH_fLPS_[E]: slkElEEEaEEEqri
120 140 160 180 200 AA: DYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSE STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: SGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD STMI: DO_DISOPRED3: ................DDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ..................................DDDDD DO_SPOTD: ........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ................DDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ....................................... RICH_[V]: VllssVrrsV