Q53S33 BOLA3_HUMAN
Gene name: BOLA3
Protein name: BolA-like protein 3
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q14088 | RAB33A | 0.74805 | immune system process GO:0002376 protein transport GO:0015031 signal transduction GO:0007165 ... |
| 2 | Q9BXJ7 | AMN | 0.74278 | anatomical structure development GO:0048856 protein transport GO:0015031 small molecule metabolic process GO:0044281 ... |
| 3 | Q9UFN0 | NIPSNAP3A | 0.74278 | |
| 4 | Q6ZMK1 | CYHR1 | 0.69295 | |
| 5 | Q96SQ9 | CYP2S1 | 0.68987 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 6 | P05177 | CYP1A2 | 0.67876 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 7 | O75881 | CYP7B1 | 0.6692 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 8 | Q8TDX6 | CSGALNACT1 | 0.66436 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 9 | P08620 | FGF4 | 0.63649 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 10 | P08195 | SLC3A2 | 0.6328 | carbohydrate metabolic process GO:0005975 immune system process GO:0002376 transmembrane transport GO:0055085 ... |
20 40 60 80 100 AA: MAAWSPAAAAPLLRGIRGLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEIKEMHGLRI STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ DO_IUPRED2A: ...........................................................................DDDDDD.DDDDD.D........... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[AL]: AAwspAAAApLLrgirgLpL RICH_[L]: LLrgirgLpL RICH_fLPS_[A]: mAAwspAAAApllrg
AA: FTSVPKR STMI: DO_DISOPRED3: ......D DO_IUPRED2A: ....... DO_SPOTD: ...DDDD CONSENSUS: ......D CONSENSUS_MOBI: .......