P0CG34 TB15A_HUMAN

Gene name: TMSB15A
Protein name: Thymosin beta-15A

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O75586 MED6 0.88567 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
2 P63313 TMSB10 0.85961 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
protein-containing complex assembly GO:0065003
3 Q9UKF2 ADAM30 0.85868 reproduction GO:0000003
4 B7Z8K6 TRDC 0.84564 immune system process GO:0002376
membrane organization GO:0061024
response to stress GO:0006950
...
5 Q15785 TOMM34 0.81318 protein targeting GO:0006605
protein transport GO:0015031
transport GO:0006810
6 O75343 GUCY1B2 0.7757 signal transduction GO:0007165
7 Q13061 TRDN 0.76556 circulatory system process GO:0003013
cytoskeleton organization GO:0007010
homeostatic process GO:0042592
...
8 Q8N7X0 ADGB 0.75805
9 Q96BK5 PINX1 0.74127 biosynthetic process GO:0009058
cell cycle GO:0007049
cell population proliferation GO:0008283
...
10 Q9NZH5 PTTG2 0.73425 cell cycle GO:0007049
chromosome organization GO:0051276
chromosome segregation GO:0007059
...

                                           20                  40               
AA:                      MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS
STMI:                                                                 
DO_DISOPRED3:            DDDD...DDD.......DDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[K]:                   KpdlseveKfdrsKlKKtnteeKntlpsKetiqqeK      
RICH_[T]:                                    TnTeeknTlpskeT           
RICH_[EK]:                       EvEKfdrsKlKKtntEEK                   
RICH_[ET]:                                   TnTEEknTlpskETiqqEkE     
RICH_[KT]:                               KlKKTnTeeKnTlpsKeTiqqeK      
RICH_MOBI_[K]:              KpdlseveKfdrsKlKKtnteeKntlpsKetiqqeK      
RICH_MOBI_[T]:                               TnTeeknTlpskeT           
RICH_MOBI_[EK]:                  EvEKfdrsKlKKtntEEK                   
RICH_MOBI_[ET]:                              TnTEEknTlpskETiqqEkE     
RICH_MOBI_[KT]:                          KlKKTnTeeKnTlpsKeTiqqeK