P0DH78 RN224_HUMAN
Gene name: RNF224
Protein name: RING finger protein 224
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5T0D9 | TPRG1L | 0.95784 | cell-cell signaling GO:0007267 |
| 2 | Q9H2C2 | ARV1 | 0.88893 | biosynthetic process GO:0009058 membrane organization GO:0061024 plasma membrane organization GO:0007009 ... |
| 3 | P0DMV8 | HSPA1A | 0.88499 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 4 | Q7RTY9 | PRSS41 | 0.88192 | |
| 5 | Q14576 | ELAVL3 | 0.87684 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 6 | P30154 | PPP2R1B | 0.82379 | anatomical structure development GO:0048856 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 7 | Q4G148 | GXYLT1 | 0.82116 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 8 | Q9Y3D2 | MSRB2 | 0.77856 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 ... |
| 9 | Q13253 | NOG | 0.77638 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 10 | Q9UK05 | GDF2 | 0.77522 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MQDAAAGGPPGLGGGGPPEERTDCIICCSAYDLSGHLPRRLYCGHTFCQACVRRLDTPAPEQRWIPCPQCRQSTPTPRGGVAMLDLDLAAFLAVKAEREP STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDD................................................................................ DO_IUPRED2A: DDDDDDDDDDDDDDDD.................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDD.............................................................................DDDD CONSENSUS: DDDDDDDDDDDDDDDDDDD................................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[AG]: AAAGGppGlG RICH_[G]: GGppGlGGGG RICH_[GP]: PPGlGGGGPP RICH_fLPS_[G]: qdaaaGGppGlGGGG
120 140 AA: ARLEPLPLTSLKGSAITRQPAGLCPALGPQPHFPQPRYCCWGCGSLCCPPLGSPEV STMI: DO_DISOPRED3: .....DDDDDDDD........................................... DO_IUPRED2A: ...DD.D................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDD...................................DD. CONSENSUS: ...DDDDDDDDDD........................................... CONSENSUS_MOBI: ........................................................