Q13253 NOGG_HUMAN
Gene name: NOG
Protein name: Noggin
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- embryo development GO:0009790
- growth GO:0040007
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q66LE6 | PPP2R2D | 0.99941 | cell cycle GO:0007049 cell division GO:0051301 cellular protein modification process GO:0006464 ... |
| 2 | Q6UW01 | CBLN3 | 0.99664 | |
| 3 | Q4G148 | GXYLT1 | 0.85397 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 4 | Q9H2C2 | ARV1 | 0.8513 | biosynthetic process GO:0009058 membrane organization GO:0061024 plasma membrane organization GO:0007009 ... |
| 5 | Q7RTY9 | PRSS41 | 0.81601 | |
| 6 | P30154 | PPP2R1B | 0.78559 | anatomical structure development GO:0048856 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 7 | P0DH78 | RNF224 | 0.77638 | |
| 8 | Q9Y295 | DRG1 | 0.73106 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 9 | Q9ULT0 | TTC7A | 0.73106 | anatomical structure development GO:0048856 homeostatic process GO:0042592 immune system process GO:0002376 |
| 10 | P47972 | NPTX2 | 0.72445 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 |
20 40 60 80 100 AA: MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAED STMI: SSSSSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD................................................................DDDDDDDDDDDDDD DO_IUPRED2A: ............................DDDDDD.......D..D.DD.....DD.DD..................DDDDDDDDDDDDDDDDDDDDD... DO_SPOTD: DDDDDDDDDDDDDDDD......................................................................DDDDDDDDDDDDDD CONSENSUS: ...........................................................DDDDDDDDDDDDDD CONSENSUS_MOBI: .............................................................DDDDDDD..... RICH_[AG]: GGGGGAAGGAed RICH_fLPS_[G]: rpGGGGGaaGGaed
120 140 160 180 200 AA: LAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHL STMI: DO_DISOPRED3: DD.................................................................................................. DO_IUPRED2A: ........D........................................................................................... DO_SPOTD: DD...........................DDDDD.................................................................. CONSENSUS: DD.................................................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[AG]: lA RICH_fLPS_[G]: l
220 AA: TVLRWRCQRRGGQRCGWIPIQYPIISECKCSC STMI: DO_DISOPRED3: ................................ DO_IUPRED2A: ................................ DO_SPOTD: ................................ CONSENSUS: ................................ CONSENSUS_MOBI: ................................