P0DMQ9 CH089_HUMAN
Gene name: C8orf89
Protein name: Putative uncharacterized protein C8orf89
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P10646 | TFPI | 0.64941 | response to stress GO:0006950 |
| 2 | P19105 | MYL12A | 0.64941 | cell adhesion GO:0007155 response to stress GO:0006950 |
| 3 | P62847 | RPS24 | 0.57791 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 4 | P21439 | ABCB4 | 0.57735 | homeostatic process GO:0042592 membrane organization GO:0061024 transmembrane transport GO:0055085 ... |
| 5 | Q9P1P4 | TAAR3P | 0.57735 | nervous system process GO:0050877 |
| 6 | Q7Z5J8 | ANKAR | 0.53616 | |
| 7 | Q5T2T1 | MPP7 | 0.53604 | cell junction organization GO:0034330 cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
| 8 | Q9UK45 | LSM7 | 0.53294 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 9 | Q9H0A6 | RNF32 | 0.51318 | |
| 10 | Q12882 | DPYD | 0.50469 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MSVLSPEIKCETSKFTRSSFGSCLIFESSWKKAVLETQKIKKEYTTAFGLEELKECIKMPYLPGLQSCQKSVSSTPLEVPKRLPRADAEVSAVRLKKTKE STMI: DO_DISOPRED3: DDDDDDDDDDDDDDD..................................................................................... DO_IUPRED2A: ..............................................................................D..................... DO_SPOTD: DDDDDDDDDDDDDDDDDDD.D..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDD...............................................................D..................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 AA: TCSVAPLWEKSKGSGFSDPLTGAPSQYLERLSKIAILEYDTIRQETTTKSKKSKKRDLRDR STMI: DO_DISOPRED3: ...............................................DDDDDDDDDDDDDD DO_IUPRED2A: .............................................DDDDDDDDDDDDDDDD DO_SPOTD: DDDDDDDDDDDDDDD...D....D........DDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .............................................DDDDDDDDDDDDDDDD CONSENSUS_MOBI: ............................................................. RICH_[KR]: KsKKRdlRdR RICH_[KT]: TTTKsKKsKK RICH_fLPS_[K]: tttKsKKsKK