P62847 RS24_HUMAN

Gene name: RPS24
Protein name: 40S ribosomal protein S24

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- homeostatic process GO:0042592
- immune system process GO:0002376
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- ribosome biogenesis GO:0042254
- translation GO:0006412
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5T2T1 MPP7 0.95434 cell junction organization GO:0034330
cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
2 P10646 TFPI 0.88102 response to stress GO:0006950
3 P62753 RPS6 0.88073 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
4 Q8IZU8 DSEL 0.8788 biosynthetic process GO:0009058
small molecule metabolic process GO:0044281
5 Q92466 DDB2 0.81384 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
6 Q9HBE4 IL21 0.8132 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
7 Q15388 TOMM20 0.80028 catabolic process GO:0009056
cellular component assembly GO:0022607
cellular protein modification process GO:0006464
...
8 P62241 RPS8 0.7687 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
9 Q9NYL4 FKBP11 0.75204
10 Q9BZA0 TTTY10 0.75204

                                           20                  40                  60                  80                 100
AA:                      MNDTVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKK
STMI:                                                                                                                        
DO_DISOPRED3:            DD..................................................................................................
DO_IUPRED2A:             D..........D................D......DD.DDDDDD...........................................DDDDDDDDDDDDD
DO_SPOTD:                DD..........................................................................................DDDDDDDD
CONSENSUS:               DD..........................................................................................DDDDDDDD
CONSENSUS_MOBI:          D...................................................................................................
RICH_[K]:                                                                                                                  KK
RICH_[R]:                                                                                                            Rhglyekk
RICH_[KR]:                                                                                                           RhglyeKK
RICH_fLPS_[K]:                                                                                                             KK

                                          120       
AA:                      KTSRKQRKERKNRMKKVRGTAKANVGAGKKPKE
STMI:                                                     
DO_DISOPRED3:            ...........D.DDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ................................D
RICH_[AG]:                                 GtAkAnvGAG     
RICH_[AK]:                                   AKAnvgAgKK   
RICH_[K]:                KtsrKqrKerKnrmKKvrgtaKanvgagKKpK 
RICH_[R]:                ktsRkqRkeRknRmkkvR               
RICH_[KR]:               KtsRKqRKeRKnRmKKvRgtaK           
RICH_fLPS_[K]:           KtsrKqrKerKnrmKKvrgtaKanvgagKKpK