P19105 ML12A_HUMAN
Gene name: MYL12A
Protein name: Myosin regulatory light chain 12A
List of terms from Generic GO subset, which this protein is a part of:
- cell adhesion GO:0007155
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q12882 | DPYD | 0.874 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 2 | O76093 | FGF18 | 0.68579 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 3 | Q8NCS4 | TMEM35B | 0.67488 | |
| 4 | Q9ULV4 | CORO1C | 0.67326 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 5 | P0DMQ9 | C8orf89 | 0.64941 | |
| 6 | Q9H0A6 | RNF32 | 0.6317 | |
| 7 | Q96RL7 | VPS13A | 0.61933 | anatomical structure development GO:0048856 catabolic process GO:0009056 protein targeting GO:0006605 ... |
| 8 | Q7Z5J8 | ANKAR | 0.61199 | |
| 9 | Q8IYB8 | SUPV3L1 | 0.61037 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 10 | Q16695 | H3-4 | 0.60454 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
20 40 60 80 100 AA: MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPED STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD....DD..................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDD.DD.............D...............................DDDDDDD.......................... DO_SPOTD: DDDDDDDDDDDDDDDDDDD................................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[T]: TkTkTkkrpqraT RICH_[KT]: KrTKTKTKKrpqraT RICH_fLPS_[K]: sKrtKtKtKK
120 140 160 AA: VIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD STMI: DO_DISOPRED3: ..................................................................DDDDD DO_IUPRED2A: ...........................................D........................... DO_SPOTD: .................................................................DDDDDD CONSENSUS: ..................................................................DDDDD CONSENSUS_MOBI: .......................................................................