P18621 RL17_HUMAN
Gene name: RPL17
Protein name: 60S ribosomal protein L17
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5H9U9 | DDX60L | 0.87505 | |
| 2 | Q07325 | CXCL9 | 0.86955 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 3 | Q15198 | PDGFRL | 0.82649 | |
| 4 | Q9H7B2 | RPF2 | 0.82174 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 protein-containing complex assembly GO:0065003 ... |
| 5 | Q5VTH2 | CFAP126 | 0.81775 | |
| 6 | Q9NRQ5 | SMCO4 | 0.8137 | |
| 7 | P49591 | SARS1 | 0.81266 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 8 | P24844 | MYL9 | 0.80915 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 9 | Q9GZR5 | ELOVL4 | 0.80913 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 10 | A0A1B0GTY4 | TEX50 | 0.80802 |
20 40 60 80 100 AA: MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAES STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: ..DD....DDD.D.D.DDDDDDDD.DDD......DDD............................................................... DO_SPOTD: DDD.DDDDDDDDDD...................................................................................... CONSENSUS: DDD.....DDDDD....................................................................................... CONSENSUS_MOBI: D...................................................................................................
120 140 160 180 AA: NAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLKKQKLMARE STMI: DO_DISOPRED3: ..............................................................DDDDDDDD.....DD.....DD DO_IUPRED2A: .......................DDDDDDDDDD.D.....................DDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: ...........................................................DDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...........................................................DDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[K]: KKKisqKKlKKqK RICH_[KQ]: QKKKisQKKlKKQK RICH_fLPS_[K]: peeevaqKKKisqKKlKKqK RICH_MOBI_[K]: KpeeevaqKKKisqKKlKKqK RICH_MOBI_[IK]: IvpKpeeevaqKKKIsqKK RICH_MOBI_[KQ]: QKKKisQKKlKKQK RICH_fLPS_MOBI_[K]: KpeeevaqKKKisqKKlKKqK