Q8NCS4 TM35B_HUMAN
Gene name: TMEM35B
Protein name: Transmembrane protein 35B
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q12882 | DPYD | 0.87416 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 2 | O15144 | ARPC2 | 0.70711 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 3 | P19105 | MYL12A | 0.67488 | cell adhesion GO:0007155 response to stress GO:0006950 |
| 4 | P0DMQ9 | C8orf89 | 0.57735 | |
| 5 | P10966 | CD8B | 0.51793 | biological process involved in symbiotic interaction GO:0044403 immune system process GO:0002376 signal transduction GO:0007165 |
| 6 | Q8N972 | ZNF709 | 0.51464 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 7 | O43405 | COCH | 0.50367 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 8 | Q16695 | H3-4 | 0.47988 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 9 | O76093 | FGF18 | 0.47782 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 10 | P17252 | PRKCA | 0.44992 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MALLLSVLRVLLGGFFALVGLAKLSEEISAPVSERMNALFVQFAEVFPLKVFGYQPDPLNYQIAVGFLELLAGLLLVMGPPMLQEISNLFLILLMMGAIF STMI: SSSSSSSSSSSSSSSSSSSSSS MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDD.................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDD............................................................................................ CONSENSUS: ........................................ . CONSENSUS_MOBI: ........................................ .
120 140 AA: TLAALKESLSTCIPAIVCLGFLLLLNVGQLLAQTKKVVRPTRKKTLSTFKESWK STMI: MMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .....................................DDDDDDDDDDDDDDDDD DO_IUPRED2A: ...................................................... DO_SPOTD: ...............................DDDDDDDDDDDDDDDDDDDDD.D CONSENSUS: ...... .....DDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ...... ...................... RICH_[KT]: TrKKTlsTfK