P20336 RAB3A_HUMAN
Gene name: RAB3A
Protein name: Ras-related protein Rab-3A
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell morphogenesis GO:0000902
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- developmental maturation GO:0021700
- immune system process GO:0002376
- membrane organization GO:0061024
- nervous system process GO:0050877
- plasma membrane organization GO:0007009
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P49901 | SMCP | 0.70206 | reproduction GO:0000003 |
| 2 | Q8ND71 | GIMAP8 | 0.64345 | cell death GO:0008219 |
| 3 | P22528 | SPRR1B | 0.62892 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 4 | Q92753 | RORB | 0.62026 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 5 | P31645 | SLC6A4 | 0.61835 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 6 | Q9ULV3 | CIZ1 | 0.61294 | |
| 7 | Q8WTU0 | DDI1 | 0.60888 | catabolic process GO:0009056 |
| 8 | Q9H853 | TUBA4B | 0.60841 | cell cycle GO:0007049 cytoskeleton organization GO:0007010 mitotic cell cycle GO:0000278 |
| 9 | Q96PI1 | SPRR4 | 0.60759 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 10 | A0A1B0GVQ3 | CCDC200 | 0.60661 |
20 40 60 80 100 AA: MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFIL STMI: DO_DISOPRED3: DDDDDDDDDDDDDD...................................................................................... DO_IUPRED2A: .......D............................................................................................ DO_SPOTD: DDDDDDDDDDDDDDDD.................................................................................... CONSENSUS: DDDDDDDDDDDDDD...................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: MYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTG STMI: DO_DISOPRED3: ...........................................................................................DDDDDDDDD DO_IUPRED2A: .............................................................................................DDDDDDD DO_SPOTD: .........................................................................................DDDDDDDDDDD CONSENSUS: ...........................................................................................DDDDDDDDD CONSENSUS_MOBI: .............................................................................................DDDDDDD RICH_[PQ]: Pavtg