P35318 ADML_HUMAN

Gene name: ADM
Protein name: Pro-adrenomedullin [Cleaved into: Adrenomedullin

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- circulatory system process GO:0003013
- embryo development GO:0009790
- growth GO:0040007
- homeostatic process GO:0042592
- immune system process GO:0002376
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NVD3 SETD4 0.82122 cellular protein modification process GO:0006464
2 P52198 RND2 0.8088 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
3 A8K010 LINC00473 0.80171 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 A0A1B0GTL2 C20orf204 0.79649
5 A6NL05 FAM74A7 0.79607
6 Q9NS28 RGS18 0.78728 signal transduction GO:0007165
7 K9M1U5 IFNL4 0.78418 cellular protein modification process GO:0006464
immune system process GO:0002376
response to stress GO:0006950
...
8 Q86V25 VASH2 0.78075 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
9 Q9UNQ2 DIMT1 0.77174 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
10 Q9BTK2 n/a 0.76846

                                           20                  40                  60                  80                 100
AA:                      MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMN
STMI:                    SSSSSSSSSSSSSSSSSSSSS                                                                               
DO_DISOPRED3:            DDDDDDDDDDDDDDD....................................DDDD...................DDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..............................................................DDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDD......
DO_SPOTD:                .D......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                    ..............................DDDD.......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                               ......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD.............
RICH_[R]:                                                                                             RspedsspdaaRiRvkRyR    

                                          120                 140                 160                 180               
AA:                      NFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL
STMI:                                                                                                         
DO_DISOPRED3:            DDDD............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDD.D.......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDD.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AP]:                                                                       AgPgrtlvsskPqAhgAPAPP        
RICH_[R]:                                                     RskispqgygRRRRRslpeagpgR                        
RICH_[GR]:                                                           GyGRRRRRslpeaGpGR                        
RICH_fLPS_[R]:                                                RskispqgygRRRRRslpeagpgR                        
RICH_MOBI_[AP]:                                                                             PqAhgAPAPP        
RICH_MOBI_[R]:                                                          RRRRRslpeagpgR                        
RICH_fLPS_MOBI_[R]:                                                    gRRRRRslpeagpgR