P0C843 CI014_HUMAN
Gene name: LINC00032
Protein name: Putative uncharacterized protein encoded by LINC00032
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q92466 | DDB2 | 0.9156 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 2 | Q9HBE4 | IL21 | 0.91224 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 3 | Q15388 | TOMM20 | 0.89618 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 4 | P62753 | RPS6 | 0.8413 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | Q8IZU8 | DSEL | 0.80214 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 6 | Q6W0C5 | DPPA3 | 0.78984 | anatomical structure development GO:0048856 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 7 | O75596 | CLEC3A | 0.78711 | anatomical structure development GO:0048856 |
| 8 | P42766 | RPL35 | 0.78092 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | P0DMS9 | TMIGD3 | 0.78091 | biosynthetic process GO:0009058 cell population proliferation GO:0008283 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q13733 | ATP1A4 | 0.76043 | circulatory system process GO:0003013 homeostatic process GO:0042592 reproduction GO:0000003 ... |
20 40 60 80 100 AA: MHLHVQPLRAKGKRPKDTFNKMAHRKRHSVTSEFLSKVPDEVRQRYINLFVEKYLKVCKTEDEAVYKAKIEKKAIYERCSRRNMYVNIAVNYLKKLRDQG STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................D DO_IUPRED2A: ....DDDD.DDD.DDDDDDDDDDD............................................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................DDD CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................D CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. RICH_[K]: KgKrpKdtfnKmahrK RICH_[R]: RakgkRpkdtfnkmahRkR RICH_[KR]: RaKgKRpKdtfnKmahRKR RICH_MOBI_[K]: KgKrpKdtfnK
AA: A STMI: DO_DISOPRED3: D DO_IUPRED2A: . DO_SPOTD: D CONSENSUS: D CONSENSUS_MOBI: .