P43308 SSRB_HUMAN
Gene name: SSR2
Protein name: Translocon-associated protein subunit beta
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- embryo development GO:0009790
- protein targeting GO:0006605
- protein transport GO:0015031
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NYL4 | FKBP11 | 1 | |
| 2 | Q8N2Z9 | CENPS | 1 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell division GO:0051301 ... |
| 3 | O14807 | MRAS | 0.99973 | anatomical structure development GO:0048856 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 4 | Q13609 | DNASE1L3 | 0.99746 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 5 | Q8WW27 | APOBEC4 | 0.99746 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 6 | Q9HAW9 | UGT1A8 | 0.99589 | carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
| 7 | P62979 | RPS27A | 0.99589 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | Q00059 | TFAM | 0.99388 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | Q14CX7 | NAA25 | 0.99388 | cellular protein modification process GO:0006464 protein maturation GO:0051604 |
| 10 | Q8NEL0 | CCDC54 | 0.9916 |
20 40 60 80 100 AA: MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKA STMI: SSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDD.................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDD....................................................................................... CONSENSUS: ................................................................................... CONSENSUS_MOBI: ...................................................................................
120 140 160 180 AA: GYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKTKKN STMI: MMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .........................................................D.DD...DDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ..............................................................................DDDDD DO_SPOTD: .......................................................................DDDDDDDDDDDD CONSENSUS: ................................................. ..DDDDDDDDDDDD CONSENSUS_MOBI: ................................................. .............. RICH_[K]: KrKydtpKtKK RICH_fLPS_[K]: KrKydtpKtKK