P49238 CX3C1_HUMAN
Gene name: CX3CR1
Protein name: CX3C chemokine receptor 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell death GO:0008219
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- developmental maturation GO:0021700
- homeostatic process GO:0042592
- immune system process GO:0002376
- nervous system process GO:0050877
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q02363 | ID2 | 0.90348 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 2 | Q8TAG5 | VSTM2A | 0.90286 | cell differentiation GO:0030154 cell population proliferation GO:0008283 |
| 3 | P15907 | ST6GAL1 | 0.90016 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 4 | Q16445 | GABRA6 | 0.89443 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 5 | Q9NPH3 | IL1RAP | 0.89004 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 6 | Q7Z7C7 | STRA8 | 0.88822 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 7 | P59773 | MINAR2 | 0.87416 | |
| 8 | P28336 | NMBR | 0.87179 | signal transduction GO:0007165 |
| 9 | Q9ULD0 | OGDHL | 0.86824 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | C9JLW8 | MCRIP1 | 0.86521 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
20 40 60 80 100 AA: MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNA STMI: MMMMMMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDD........................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDD........................................................................................... CONSENSUS: DDDDDDDDD...................... .......... .......... CONSENSUS_MOBI: ............................... .......... ..........
120 140 160 180 200 AA: MCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGF STMI: MMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMMMM MMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ... ................. ............................ CONSENSUS_MOBI: ... ................. ............................
220 240 260 280 300 AA: LLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKF STMI: MMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ................ ................. ... CONSENSUS_MOBI: ................ ................. ...
320 340 AA: RRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL STMI: DO_DISOPRED3: ...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ....................................................... DO_SPOTD: ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ....................................................... RICH_[S]: SSSeSqrSrhgSvlSSnftyhtS