P52298 NCBP2_HUMAN
Gene name: NCBP2
Protein name: Nuclear cap-binding protein subunit 2
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
- nucleobase-containing compound catabolic process GO:0034655
- nucleocytoplasmic transport GO:0006913
- protein transport GO:0015031
- signal transduction GO:0007165
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A6PVI3 | NCBP2L | 0.65915 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 2 | P62633 | CNBP | 0.65274 | biosynthetic process GO:0009058 cell population proliferation GO:0008283 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | P61313 | RPL15 | 0.61727 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 4 | Q8TBK2 | SETD6 | 0.61668 | biosynthetic process GO:0009058 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | P83881 | RPL36A | 0.61397 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 6 | Q08211 | DHX9 | 0.60358 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 7 | Q9H223 | EHD4 | 0.57411 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 protein-containing complex assembly GO:0065003 ... |
| 8 | P52597 | HNRNPF | 0.55899 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 signal transduction GO:0007165 |
| 9 | Q96QS1 | TSPAN32 | 0.55533 | cell adhesion GO:0007155 cell population proliferation GO:0008283 cell-cell signaling GO:0007267 ... |
| 10 | Q92804 | TAF15 | 0.55502 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRY STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[LY]: LLkaLrsdsYveLsqY
120 140 AA: INGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ STMI: DO_DISOPRED3: ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .............................DD....DDD.................. DO_SPOTD: ...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ......................................................DD RICH_[G]: GrqyGrGrsGGqvrdeyrqdydaGrGGyG RICH_[RY]: RqYgRgRsggqvRdeYRqdYdagR RICH_[R]: RqygRgRsggqvRdeyRqdydagR RICH_[Y]: YrqdYdagrggY RICH_[DY]: DeYrqDYDagrggY RICH_[GR]: GRqyGRGRsGGqvRdeyRqdydaGRGG RICH_[GY]: GrqYGrGrsGGqvrdeYrqdYdaGrGGYG RICH_fLPS_[Y]: rdeYrqdYdagrggY