P56539 CAV3_HUMAN
Gene name: CAV3
Protein name: Caveolin-3
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- catabolic process GO:0009056
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- circulatory system process GO:0003013
- cytoskeleton organization GO:0007010
- growth GO:0040007
- homeostatic process GO:0042592
- membrane organization GO:0061024
- plasma membrane organization GO:0007009
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y239 | NOD1 | 0.61812 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
| 2 | Q9BUL8 | PDCD10 | 0.59136 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 3 | Q8WWM9 | CYGB | 0.58486 | biosynthetic process GO:0009058 response to stress GO:0006950 small molecule metabolic process GO:0044281 ... |
| 4 | Q96MB7 | HARBI1 | 0.51682 | |
| 5 | Q9P0W0 | IFNK | 0.48685 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 6 | Q96K49 | TMEM87B | 0.45992 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 7 | Q8WVF2 | UCMA | 0.44721 | anatomical structure development GO:0048856 cell differentiation GO:0030154 embryo development GO:0009790 |
| 8 | Q9NY87 | SPANXC | 0.44521 | |
| 9 | Q9NS26 | SPANXA1 | 0.43959 | reproduction GO:0000003 |
| 10 | Q99884 | SLC6A7 | 0.34762 | transport GO:0006810 |
20 40 60 80 100 AA: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHI STMI: IIIIIIIIIIIIIIIII DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... CONSENSUS: DDDDDDDDDDDDDDDDD.................................................................. CONSENSUS_MOBI: ................................................................................... RICH_[EM]: MMaEEhtdlE
120 140 AA: WAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV STMI: IIII DO_DISOPRED3: ..................................................D DO_IUPRED2A: ................................................... DO_SPOTD: .................................................DD CONSENSUS: ..............................................D CONSENSUS_MOBI: ...............................................