P57077 M3KCL_HUMAN
Gene name: MAP3K7CL
Protein name: MAP3K7 C-terminal-like protein
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O15389 | SIGLEC5 | 0.59349 | cell adhesion GO:0007155 immune system process GO:0002376 transport GO:0006810 ... |
| 2 | Q9H3Y6 | SRMS | 0.59261 | cell differentiation GO:0030154 cell population proliferation GO:0008283 cellular protein modification process GO:0006464 ... |
| 3 | Q9NY64 | SLC2A8 | 0.59261 | carbohydrate metabolic process GO:0005975 cell cycle GO:0007049 membrane organization GO:0061024 ... |
| 4 | Q9BZR9 | TRIM8 | 0.55711 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | A6NHR8 | FAM47DP | 0.55094 | |
| 6 | Q8N5N4 | C3orf22 | 0.52441 | |
| 7 | P08246 | ELANE | 0.51992 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | O75147 | OBSL1 | 0.51925 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 9 | H3BNL1 | C3orf84 | 0.51803 | |
| 10 | Q6UVK1 | CSPG4 | 0.51495 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MVQLIAPLEVMWNEAADLKPLALSRRLECSGGIMAHYSPDLLGPEMESRYFAQVGLEHLASSSPPAFGFLKCLDYSISVLCSATSLAMLEDNPKVSKLAT STMI: DO_DISOPRED3: D.........................................DDDDDDDDDDDDDDDDDDDDD...............DDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: D.........................................DDDDDDDDDDDDDDDDDDDDD...............DDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................................................................... RICH_[K]: KvsKlat
120 140 160 180 200 AA: GDWMLTLKPKSITVPVEIPSSPLDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDA STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: ...............DDDDDDDDDD.DDDDDD.DD.DD......DDDD.DDD.D...................................D.......... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[K]: gdwmltlKpK RICH_[P]: PksitvPveiPssPlddtPP RICH_[DI]: IpssplDDtppeDsI RICH_[DP]: PssPlDDtPPeDsiP
220 240 AA: AELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS STMI: DO_DISOPRED3: .................................DDDDDDDDD DO_IUPRED2A: .......................................... DO_SPOTD: .................................DDDDDDDDD CONSENSUS: .................................DDDDDDDDD CONSENSUS_MOBI: ..........................................