List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	P60606	CTXN1	1
2	Q16613	AANAT	0.99941	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ...
3	A0PG75	PLSCR5	0.99837	membrane organization GO:0061024 plasma membrane organization GO:0007009 transport GO:0006810
4	Q14626	IL11RA	0.99555	anatomical structure development GO:0048856 cell population proliferation GO:0008283 signal transduction GO:0007165
5	P50281	MMP14	0.98872	anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ...
6	O75880	SCO1	0.98668	catabolic process GO:0009056 cellular component assembly GO:0022607 homeostatic process GO:0042592 ...
7	Q8IY18	SMC5	0.98535	cell cycle GO:0007049 cell division GO:0051301 cellular nitrogen compound metabolic process GO:0034641 ...
8	Q9BQI0	AIF1L	0.96476	cellular component assembly GO:0022607 cytoskeleton organization GO:0007010
9	Q9Y4U1	MMACHC	0.92842	cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281
10	O75871	CEACAM4	0.91521	transport GO:0006810 vesicle-mediated transport GO:0016192

                                           20                  40                  60                  80                  
AA:                      MSATWTLSPEPLPPSTGPPVGAGLDAEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRMPASSWTDHKEALERGQFDYALV
STMI:                                                 MMMMMMMMMMMMMMMMMMMMM                                
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDD..............................................................
DO_IUPRED2A:             .......DD.DDD..DDDDDD.............................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDD........                     ................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDD........                     ................................
RICH_[P]:                        PePlPPstgPP                                                               
RICH_MOBI_[P]:                   PePlPPstgPP