P62266 RS23_HUMAN
Gene name: RPS23
Protein name: 40S ribosomal protein S23
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q9HBE4 | IL21 | 0.82263 |
anatomical structure development
GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
2 | Q92466 | DDB2 | 0.82115 |
cellular component assembly
GO:0022607 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
3 | Q15388 | TOMM20 | 0.80918 |
catabolic process
GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
4 | Q9NV72 | ZNF701 | 0.79413 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
5 | P0DMS9 | TMIGD3 | 0.78399 |
biosynthetic process
GO:0009058 cell population proliferation GO:0008283 cellular nitrogen compound metabolic process GO:0034641 ... |
6 | Q09FC8 | ZNF415 | 0.78135 | |
7 | Q8WV37 | ZNF480 | 0.76436 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
8 | Q07020 | RPL18 | 0.7623 |
biological process involved in symbiotic interaction
GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
9 | Q8IZU8 | DSEL | 0.7523 |
biosynthetic process
GO:0009058 small molecule metabolic process GO:0044281 |
10 | Q5T2T1 | MPP7 | 0.74999 |
cell junction organization
GO:0034330 cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
20 40 60 80 100
AA: MGKCRGLRTARKLRSHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEV
STMI:
DO_DISOPRED3: DDDD...DDD.DD..........DDDDD.DDDDDDDDD..............................................................
DO_IUPRED2A: .......DDDDDDDDDDDDDDDDDD...........................................................................
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................
CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................................
CONSENSUS_MOBI: D...................................................................................................
RICH_[K]: KlrshrrdqKwhdKqyKKahlgtalK
RICH_[R]: RglRtaRklRshRR
RICH_[HR]: RsHRRdqkwH
RICH_[KR]: RKlRshRRdqKwhdKqyKK
RICH_fLPS_[R]: mgkcRglRtaRklRshRRdq
120 140
AA: LVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS
STMI:
DO_DISOPRED3: ......................................DDDDD
DO_IUPRED2A: .........................................DD
DO_SPOTD: ....................................DDDDDDD
CONSENSUS: ......................................DDDDD
CONSENSUS_MOBI: ..........................................D