Q15388 TOM20_HUMAN
Gene name: TOMM20
Protein name: Mitochondrial import receptor subunit TOM20 homolog
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- membrane organization GO:0061024
- protein targeting GO:0006605
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q92466 | DDB2 | 0.97735 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 2 | Q9HBE4 | IL21 | 0.9658 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 3 | P62753 | RPS6 | 0.92961 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 4 | P61587 | RND3 | 0.8966 | cell adhesion GO:0007155 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 5 | P0C843 | LINC00032 | 0.89618 | |
| 6 | Q5T0J7 | TEX35 | 0.88697 | |
| 7 | Q9NV72 | ZNF701 | 0.86557 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | Q8IZU8 | DSEL | 0.85313 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 9 | P0DMS9 | TMIGD3 | 0.84007 | biosynthetic process GO:0009058 cell population proliferation GO:0008283 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q5T2T1 | MPP7 | 0.83781 | cell junction organization GO:0034330 cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
20 40 60 80 100 AA: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVC STMI: MMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDD..............................DDDDDDDD................................................ DO_IUPRED2A: .................................DDDDDDDDD......D................................................... DO_SPOTD: DDDD.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................... CONSENSUS: DDDD.. .........DDDDDDDDDDDDDDDDDDD................................................ CONSENSUS_MOBI: ...... ............................................................................ RICH_[K]: KnrlrerrKKqKlaK RICH_[R]: RlReRRkkqklakeR RICH_[KR]: KnRlReRRKK
120 140 AA: GQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE STMI: DO_DISOPRED3: .................................DDDDDDDDDDDD DO_IUPRED2A: ............................................D DO_SPOTD: .............................DDDDDDDDDDDDDDDD CONSENSUS: .................................DDDDDDDDDDDD CONSENSUS_MOBI: .............................................