Q07020 RL18_HUMAN
Gene name: RPL18
Protein name: 60S ribosomal protein L18
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6T310 | RASL11A | 0.89054 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 signal transduction GO:0007165 |
| 2 | P61587 | RND3 | 0.82139 | cell adhesion GO:0007155 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 3 | Q9Y3A4 | RRP7A | 0.82135 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cellular component assembly GO:0022607 ... |
| 4 | Q9NUL7 | DDX28 | 0.81252 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 ribonucleoprotein complex assembly GO:0022618 ... |
| 5 | P33681 | CD80 | 0.80008 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 6 | O60762 | DPM1 | 0.79419 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 7 | Q6ZV65 | FAM47E | 0.78315 | |
| 8 | Q5T0J7 | TEX35 | 0.77301 | |
| 9 | P62266 | RPS23 | 0.7623 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 10 | A0A1B0GTL2 | C20orf204 | 0.76181 |
20 40 60 80 100 AA: MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKV STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDD.................................................................................. DO_IUPRED2A: DD..DDDDDDDDDD.DD.............................................DDDDDDDD.............................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDD.................................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[R]: RhnkdRkvRR
120 140 160 180 AA: CALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN STMI: DO_DISOPRED3: .............................................................DD.DDD.................DD.D DO_IUPRED2A: ....................................D..DD......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: ...........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ........................................................................................ RICH_[H]: HfgkapgtpHsH RICH_[K]: KapgtphshtKpyvrsKgrK RICH_[R]: RskgRkfeRaRgRRasR RICH_fLPS_[R]: pyvRskgRkfeRaRgRRasR