Q8TDV5 GP119_HUMAN
Gene name: GPR119
Protein name: Glucose-dependent insulinotropic receptor
List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q9BQ90 | KLHDC3 | 0.73994 | cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
2 | P62277 | RPS13 | 0.67267 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
3 | Q6UXV0 | GFRAL | 0.54054 | anatomical structure development GO:0048856 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
4 | Q9H7T0 | CATSPERB | 0.52322 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
5 | Q8TCS8 | PNPT1 | 0.52322 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell cycle GO:0007049 ... |
6 | P54710 | FXYD2 | 0.51073 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
7 | Q96DX5 | ASB9 | 0.45187 | catabolic process GO:0009056 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
8 | P52741 | ZNF134 | 0.45078 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
9 | P31942 | HNRNPH3 | 0.41015 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 ... |
10 | Q96G79 | SLC35A4 | 0.37545 | transport GO:0006810 |
20 40 60 80 100 AA: MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLIT STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDD............................................................................................... CONSENSUS: DDDDD....... .... ....................... CONSENSUS_MOBI: ............ .... .......................
120 140 160 180 200 AA: FDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIR STMI: MM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ....................... .................. ............... CONSENSUS_MOBI: ....................... .................. ...............
220 240 260 280 300 AA: KMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKV STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .DDDDDDDDDDDDD...................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .DDDDDDDDDDDDDDDD................................................................................... CONSENSUS: .DDDDDDDDDDDDD............ ............... ................. CONSENSUS_MOBI: .......................... ............... ................. RICH_[GM]: MehaGaMaGG
320 AA: LTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG STMI: DO_DISOPRED3: ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ................................... DO_SPOTD: .........DDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .........DDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ................................... RICH_[IS]: SSchIvtISSS