Q96G79 S35A4_HUMAN
Gene name: SLC35A4
Protein name: Probable UDP-sugar transporter protein SLC35A4
List of terms from Generic GO subset, which this protein is a part of:
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q69YG0 | TMEM42 | 0.82809 | |
| 2 | O75147 | OBSL1 | 0.78493 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 3 | P41273 | TNFSF9 | 0.75826 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 4 | Q14164 | IKBKE | 0.72439 | biological process involved in symbiotic interaction GO:0044403 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 5 | Q96L94 | SNX22 | 0.7012 | protein transport GO:0015031 transport GO:0006810 |
| 6 | Q8N1D0 | SLC22A18AS | 0.68756 | |
| 7 | Q9H190 | SDCBP2 | 0.68576 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 signal transduction GO:0007165 ... |
| 8 | P0C864 | DANCR | 0.68392 | |
| 9 | Q4LDE5 | SVEP1 | 0.67672 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 10 | Q9BSR8 | YIPF4 | 0.6548 | biological process involved in symbiotic interaction GO:0044403 |
20 40 60 80 100 AA: MSVEDGGMPGLGRPRQARWTLMLLLSTAMYGAHAPLLALCHVDGRVPFRPSSAVLLTELTKLLLCAFSLLVGWQAWPQGPPPWRQAAPFALSALLYGANN STMI: MMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... DO_IUPRED2A: .....D.D............................................................................................ DO_SPOTD: DDDDDDDDDDDDDDD..................................................................................... CONSENSUS: DDDDDDDDDDDDDDD.... ........... ......... CONSENSUS_MOBI: ................... ........... ......... RICH_[GM]: MsvedGGMpG
120 140 160 180 200 AA: NLVIYLQRYMDPSTYQVLSNLKIGSTAVLYCLCLRHRLSVRQGLALLLLMAAGACYAAGGLQVPGNTLPSPPPAAAASPMPLHITPLGLLLLILYCLISG STMI: MMMMM MMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...............................................................DDDDDDDDDDDDDDDDD.................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: ..........................................................DDDDDDDDDDDDDDDDDDDDDDDDD................. CONSENSUS: ...................................... DDDDDDDDDDDDDDDDD.. CONSENSUS_MOBI: ...................................... ................... RICH_[AP]: PsPPPAAAAsP RICH_[P]: PgntlPsPPP
220 240 260 280 300 AA: LSSVYTELLMKRQRLPLALQNLFLYTFGVLLNLGLHAGGGSGPGLLEGFSGWAALVVLSQALNGLLMSAVMKHGSSITRLFVVSCSLVVNAVLSAVLLRL STMI: MMMMM MMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ........... ......... .... .. CONSENSUS_MOBI: ........... ......... .... ..
320 AA: QLTAAFFLATLLIGLAMRLYYGSR STMI: MMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ........................ DO_IUPRED2A: ........................ DO_SPOTD: .....................DDD CONSENSUS: .. .. CONSENSUS_MOBI: .. ..