P62316 SMD2_HUMAN
Gene name: SNRPD2
Protein name: Small nuclear ribonucleoprotein Sm D2
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
- nucleocytoplasmic transport GO:0006913
- protein-containing complex assembly GO:0065003
- ribonucleoprotein complex assembly GO:0022618
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NXF1 | TEX10 | 0.90798 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 2 | P61254 | RPL26 | 0.76859 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 3 | P17252 | PRKCA | 0.76121 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 4 | Q9BZA0 | TTTY10 | 0.73621 | |
| 5 | Q8N2Z9 | CENPS | 0.73621 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell division GO:0051301 ... |
| 6 | Q9NYL4 | FKBP11 | 0.73621 | |
| 7 | O14807 | MRAS | 0.73601 | anatomical structure development GO:0048856 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 8 | Q8WW27 | APOBEC4 | 0.73434 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 9 | Q13609 | DNASE1L3 | 0.73434 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 10 | Q9HAW9 | UGT1A8 | 0.73319 | carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
20 40 60 80 100 AA: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMF STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDD.................................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDD.DDDDD.............................................DDDDDDDDDDDDDD.......... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD.......................................................DDDDDDDDDDDD........... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD.......................................................DDDDDDDDDDDD........... CONSENSUS_MOBI: D................................................................................................... RICH_[E]: EmtpEElqkrEEE RICH_[K]: KsgKgKKKsK RICH_fLPS_[K]: KsgKgKKKsK
AA: LRGDSVIVVLRNPLIAGK STMI: DO_DISOPRED3: ...............DDD DO_IUPRED2A: .................. DO_SPOTD: ..............DDDD CONSENSUS: ...............DDD CONSENSUS_MOBI: ..................