P46781 RS9_HUMAN
Gene name: RPS9
Protein name: 40S ribosomal protein S9
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- ribosome biogenesis GO:0042254
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | P30154 | PPP2R1B | 0.80068 | anatomical structure development GO:0048856 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
2 | P62805 | H4C1 | 0.76479 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
3 | Q99525 | H4C7 | 0.72964 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
4 | Q7RTY9 | PRSS41 | 0.72411 | |
5 | Q9H2C2 | ARV1 | 0.71977 | biosynthetic process GO:0009058 membrane organization GO:0061024 plasma membrane organization GO:0007009 ... |
6 | Q9Y263 | PLAA | 0.7163 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
7 | Q9NZ38 | IDI2-AS1 | 0.7163 | |
8 | Q9UK05 | GDF2 | 0.71607 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
9 | Q9Y3D2 | MSRB2 | 0.71531 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 ... |
10 | Q86SK9 | SCD5 | 0.71226 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
20 40 60 80 100 AA: MPVARSWVCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGL STMI: DO_DISOPRED3: DDDDD............................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D..................................................................... CONSENSUS: DDDDD............................................................................................... CONSENSUS_MOBI: D...................................................................................................
120 140 160 180 AA: KIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKNAKKGQGGAGAGDDEEED STMI: DO_DISOPRED3: ...........................................................................DDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .............................................................D.....DDDDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: ..............................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ......................................................................................DDDDDDDD RICH_[AG]: AkkGqGGAGA RICH_[G]: GrpGrvkrknakkGqGGaGaG RICH_[DG]: GqGGaGaGDDeeeD RICH_[EG]: GaGaGddEEE RICH_[GK]: GrpGrvKrKnaKKGqGGaGaG RICH_fLPS_[G]: GrpGrvkrknakkGqGGaGaG