Q9Y324 FCF1_HUMAN
Gene name: FCF1
Protein name: rRNA-processing protein FCF1 homolog
List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
- ribosome biogenesis GO:0042254
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P24844 | MYL9 | 0.99563 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 2 | Q92963 | RIT1 | 0.99361 | signal transduction GO:0007165 |
| 3 | Q9NRQ5 | SMCO4 | 0.98357 | |
| 4 | A0A1B0GTY4 | TEX50 | 0.96235 | |
| 5 | Q6NW29 | RWDD4 | 0.95744 | |
| 6 | Q9Y291 | MRPS33 | 0.95131 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 7 | Q16363 | LAMA4 | 0.9453 | anatomical structure development GO:0048856 cell adhesion GO:0007155 embryo development GO:0009790 ... |
| 8 | P42127 | ASIP | 0.94331 | biosynthetic process GO:0009058 cell-cell signaling GO:0007267 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | Q96A08 | H2BC1 | 0.92703 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 10 | Q9NWT1 | PAK1IP1 | 0.91852 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 ribosome biogenesis GO:0042254 ... |
20 40 60 80 100 AA: MGKQKKTRKYATMKRMLSLRDQRLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYNTQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIP STMI: DO_DISOPRED3: DDDDDDDDDDDD...................DDDDDDDDDDDD......................................................... DO_IUPRED2A: DDDDDD......D.........DDDDDDDDDDDDDDDDDDDDDDD....................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................. CONSENSUS: DDDDDDDDDDDDD.........DDDDDDDDDDDDDDDDDDDDDDD....................................................... CONSENSUS_MOBI: .....................DDDDDDDDDDDDDDDDDDDDDDDDDD..................................................... RICH_[K]: KeKdrlKpKKKeKKdpsalK RICH_fLPS_[K]: lKeKdrlKpKKKeKKdpsalK RICH_MOBI_[K]: KeKdrlKpKKKeKKdpsalK RICH_fLPS_MOBI_[K]: lKeKdrlKpKKKeKKdpsalK
120 140 160 180 AA: CITDCVMAEIEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMPDDYGAPRF STMI: DO_DISOPRED3: ...........................................................................................DDDDDDD DO_IUPRED2A: .................................................................................................. DO_SPOTD: .............................................................................................DD.D. CONSENSUS: .............................................................................................DDDD. CONSENSUS_MOBI: ..................................................................................................