P78317 RNF4_HUMAN

Gene name: RNF4
Protein name: E3 ubiquitin-protein ligase RNF4

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- cytoskeleton organization GO:0007010
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BTK2 n/a 0.71729
2 Q92914 FGF11 0.71134 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
signal transduction GO:0007165
3 O75078 ADAM11 0.69639 signal transduction GO:0007165
4 K9M1U5 IFNL4 0.69592 cellular protein modification process GO:0006464
immune system process GO:0002376
response to stress GO:0006950
...
5 P20800 EDN2 0.68491 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell population proliferation GO:0008283
...
6 Q9NRA2 SLC17A5 0.68481 transport GO:0006810
7 Q9NRC8 SIRT7 0.68455 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cell cycle GO:0007049
...
8 Q6QEF8 CORO6 0.68287 cytoskeleton organization GO:0007010
9 Q9NVD3 SETD4 0.68039 cellular protein modification process GO:0006464
10 Q5XG85 n/a 0.67958

                                           20                  40                  60                  80                 100
AA:                      MSTRKRRGGAINSRQAQKRTREATSTPEISLEAEPIELVETAGDEIVDLTCESLEPVVVDLTHNDSVVIVDERRRPRRNARRLPQDHADSCVVSSDDEEL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D............................DDDDDDDDDDDDDDDDDDDDD.DDDDDD....
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................
RICH_[D]:                                                                                                     DhaDscvvssDDeel
RICH_[RV]:                                                                        VVdlthndsVViVdeRRRpRRnaR                   
RICH_[E]:                                     EatstpEislEaEpiElvE                                                            
RICH_[R]:                   RkRRggainsRqaqkRtR                                                   RRRpRRnaRR                  
RICH_[V]:                                                      VetagdeiVdltceslepVVVdlthndsVViV                     VVssddeel
RICH_[DV]:                                                                       VVVDlthnDsVViVD                 DscVVssDDeel
RICH_[EI]:                                          EIslEaEpIElvE                                                            
RICH_[EV]:                                                     VEtagdEiVdltcEslEpVVV                                         
RICH_fLPS_[R]:            stRkRRggainsRqaqkRtR                                         hndsvvivdeRRRpRRnaRR                  
RICH_fLPS_[RV]:                                                                 pVVVdlthndsVViVdeRRRpRRnaRR                  
RICH_fLPS_[D]:                                                                                                DhaDscvvssDDeel
RICH_fLPS_[V]:                                                             ceslepVVVdlthndsVViV                              
RICH_MOBI_[R]:              RkRRggainsRqaqkRtR                                                                               

                                          120                 140                 160                 180          
AA:                      SRDRDVYVTTHTPRNARDEGATGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI
STMI:                                                                                                              
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDD.....................................................................
DO_IUPRED2A:             .DDDDDDDDDDDDDDDDDDDDDDD..................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDD..................................................................
CONSENSUS_MOBI:          ...................DD.....................................................................
RICH_[D]:                srDrD                                                                                     
RICH_[R]:                 RdRdvyvtthtpRnaR                                                                         
RICH_[T]:                        TThTprnardegaT                                                                    
RICH_[V]:                srdrdVyV                                                                                  
RICH_[DV]:               srDrDVyV                                                                                  
RICH_fLPS_[D]:           srDrD