P86434 AAS1_HUMAN
Gene name: ADORA2A-AS1
Protein name: Putative uncharacterized protein ADORA2A-AS1
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P31994 | FCGR2B | 0.92848 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 ... |
| 2 | Q9Y226 | SLC22A13 | 0.89877 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
| 3 | Q8N402 | n/a | 0.89443 | |
| 4 | O95866 | MPIG6B | 0.88492 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 5 | Q9H840 | GEMIN7 | 0.86193 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 6 | Q5QGZ9 | CLEC12A | 0.82531 | immune system process GO:0002376 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 7 | O95229 | ZWINT | 0.81923 | cell cycle GO:0007049 cell division GO:0051301 chromosome organization GO:0051276 ... |
| 8 | Q4KMG9 | TMEM52B | 0.78935 | |
| 9 | P29122 | PCSK6 | 0.76194 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 10 | Q96FZ7 | CHMP6 | 0.74524 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cell cycle GO:0007049 ... |
20 40 60 80 100 AA: MEQDWQPGEEVTPGPEPCSKGQAPLYPIVHVTELKHTDPNFPSNSNAVGTSSGWNRIGTGCSHTWDWRFSCTQQALLPLLGAWEWSIDTEAGGGRREQSQ STMI: DO_DISOPRED3: DDD..DDDDDDDDDD..................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDD.DD.....DD......D.DDDDDDDDDDDD.....................................D.DDDDDDDDDDD DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD.............DDDD.DDDDDD..........................................DDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD.............DDDDDDDDDDD..........................................DDDDDDDDDDD CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDD...................................................................DDDDDDDDDD RICH_[EP]: EqdwqPgEEvtPgPEP
120 140 AA: KPCSNGGPAAAGEGRVLPSPCFPWSTCQAAIHKVCRWQGCTRPALLAPSLATLKEHSYP STMI: DO_DISOPRED3: .......................................................DDDD DO_IUPRED2A: DDDDDDDDDD................................................. DO_SPOTD: DDDDDDDDDDDDDD.....................................DDDDDDDD CONSENSUS: DDDDDDDDDD.............................................DDDD CONSENSUS_MOBI: DDDDDDDDDD.................................................