Q01629 IFM2_HUMAN
Gene name: IFITM2
Protein name: Interferon-induced transmembrane protein 2
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y239 | NOD1 | 0.61812 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
| 2 | Q9BUL8 | PDCD10 | 0.59136 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 3 | Q8WWM9 | CYGB | 0.58486 | biosynthetic process GO:0009058 response to stress GO:0006950 small molecule metabolic process GO:0044281 ... |
| 4 | Q96MB7 | HARBI1 | 0.51682 | |
| 5 | Q9P0W0 | IFNK | 0.48685 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 6 | Q96K49 | TMEM87B | 0.45992 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 7 | Q8WVF2 | UCMA | 0.44721 | anatomical structure development GO:0048856 cell differentiation GO:0030154 embryo development GO:0009790 |
| 8 | Q9NY87 | SPANXC | 0.44521 | |
| 9 | Q9NS26 | SPANXA1 | 0.43959 | reproduction GO:0000003 |
| 10 | Q99884 | SLC6A7 | 0.34762 | transport GO:0006810 |
20 40 60 80 100 AA: MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYAS STMI: IIIIIIIIIIIIIIIIIIIII DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................... DO_IUPRED2A: ...............DD.D.............D................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................ ....................... CONSENSUS_MOBI: ........................................................ ....................... RICH_[EM]: MlkEEqEvaM
120 AA: TAKCLNIWALILGIFMTILLIIIPVLVVQAQR STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ........................D.....DD DO_IUPRED2A: ................................ DO_SPOTD: ...........................DDDDD CONSENSUS: ...... ...DD CONSENSUS_MOBI: ...... .....