Q02535 ID3_HUMAN

Gene name: ID3
Protein name: DNA-binding protein inhibitor ID-3

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- embryo development GO:0009790
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BZR9 TRIM8 0.9401 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
2 Q8N5N4 C3orf22 0.88492
3 O75147 OBSL1 0.87622 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell cycle GO:0007049
...
4 H3BNL1 C3orf84 0.87416
5 Q9BQI0 AIF1L 0.86824 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
6 Q9UJ71 CD207 0.83826 immune system process GO:0002376
response to stress GO:0006950
transport GO:0006810
...
7 O95140 MFN2 0.83205 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
8 O14520 AQP7 0.81923 transport GO:0006810
9 Q9P283 SEMA5B 0.79543 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
10 P27986 PIK3R1 0.79262 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQ
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDD..............................................................................DDDDDDDDDDDD
DO_IUPRED2A:             ..........................DDD.....DD...................................................D..DDDDDDDDD.
DO_SPOTD:                DDDDDDDDDDDDDDDDD...DDDDDDDDDDDDDDD...................................................DDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDD................DDD.....D....................................................DDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[P]:                                                                                                        PgPPdgPhlPiq

                          
AA:                      TAELTPELVISNDKRSFCH
STMI:                                       
DO_DISOPRED3:            DDDDDDDDDDDDDDDD...
DO_IUPRED2A:             ...................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDD...
CONSENSUS_MOBI:          ...................
RICH_[P]:                taeltP