Q9UEU0 VTI1B_HUMAN
Gene name: VTI1B
Protein name: Vesicle transport through interaction with t-SNAREs homolog 1B
List of terms from Generic GO subset, which this protein is a part of:
- membrane organization GO:0061024
- protein targeting GO:0006605
- protein transport GO:0015031
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8NBJ9 | SIDT2 | 0.91915 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 2 | Q9BRY0 | SLC39A3 | 0.89443 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 embryo development GO:0009790 ... |
| 3 | Q03135 | CAV1 | 0.85749 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 4 | Q9NUV9 | GIMAP4 | 0.7935 | |
| 5 | Q13137 | CALCOCO2 | 0.77152 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 immune system process GO:0002376 ... |
| 6 | P52597 | HNRNPF | 0.60828 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 signal transduction GO:0007165 |
| 7 | Q8NE65 | ZNF738 | 0.58898 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
| 8 | P78396 | CCNA1 | 0.52945 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell division GO:0051301 ... |
| 9 | O43707 | ACTN4 | 0.50428 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 10 | P31943 | HNRNPH1 | 0.49679 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 signal transduction GO:0007165 |
20 40 60 80 100 AA: MASSAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREVRSTPL STMI: DO_DISOPRED3: DDDDDD.............................................................................................. DO_IUPRED2A: DDDDDDD.....................DDDDDDDDD.DD.DDDDDDDDDDDDDDDDDDDDDD..DD..D..D..........DD...D..DDDDDDDDD DO_SPOTD: DDDDDDD........................................................................................DDDDD CONSENSUS: DDDDDDD........................................................................................DDDDD CONSENSUS_MOBI: D.............................................................................................DD....
120 140 160 180 200 AA: TATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIERSHRIATETDQIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSR STMI: DO_DISOPRED3: ....DDDDDDDDDDDDD................................................................................... DO_IUPRED2A: DDDDDDDDD.DDDD...........DDDDDD.........D.DDDDDDDDDDD.........D......D....DDDDDDDDD................. DO_SPOTD: DDDDDDDDDDDDDD.D.DD................................................................................. CONSENSUS: DDDDDDDDDDDDDDDD.................................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[GY]: GGrGdmkYGiY
220 AA: KVTTNKLLLSIIILLELAILGGLVYYKFFRSH STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...............................D DO_IUPRED2A: ................................ DO_SPOTD: ..........................DDDDDD CONSENSUS: ........ ..D CONSENSUS_MOBI: ........ ...