Q9UKJ5 CHIC2_HUMAN
Gene name: CHIC2
Protein name: Cysteine-rich hydrophobic domain-containing protein 2
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UI26 | IPO11 | 0.99941 | nucleocytoplasmic transport GO:0006913 protein transport GO:0015031 transport GO:0006810 |
| 2 | P42857 | NSG1 | 0.99746 | cell death GO:0008219 cell-cell signaling GO:0007267 cellular component assembly GO:0022607 ... |
| 3 | Q07817 | BCL2L1 | 0.99388 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
| 4 | Q86XI2 | NCAPG2 | 0.98995 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 5 | Q9BTA0 | FAM167B | 0.98058 | |
| 6 | Q13049 | TRIM32 | 0.98058 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 7 | Q8NEV9 | IL27 | 0.97823 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 8 | Q96M32 | AK7 | 0.95506 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 9 | Q9GZL7 | WDR12 | 0.95506 | cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 ... |
| 10 | P36575 | ARR3 | 0.93405 | cellular protein modification process GO:0006464 nervous system process GO:0050877 signal transduction GO:0007165 ... |
20 40 60 80 100 AA: MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCS STMI: DO_DISOPRED3: DD....DDDDDDDDDDDDD................................................................................. DO_IUPRED2A: ..................D................................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS: DD....DDDDDDDDDDDDD................................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[E]: EEEEdEEralE RICH_fLPS_[E]: EEEEdEEralE
120 140 160 AA: MWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD STMI: DO_DISOPRED3: ................................................................. DO_IUPRED2A: ................................................................. DO_SPOTD: ................................................................D CONSENSUS: ................................................................. CONSENSUS_MOBI: .................................................................