Q6UW01 CBLN3_HUMAN
Gene name: CBLN3
Protein name: Cerebellin-3
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q66LE6 | PPP2R2D | 0.99887 | cell cycle GO:0007049 cell division GO:0051301 cellular protein modification process GO:0006464 ... |
| 2 | Q13253 | NOG | 0.99664 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 3 | Q4G148 | GXYLT1 | 0.85639 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 4 | Q9H2C2 | ARV1 | 0.84905 | biosynthetic process GO:0009058 membrane organization GO:0061024 plasma membrane organization GO:0007009 ... |
| 5 | Q7RTY9 | PRSS41 | 0.81557 | |
| 6 | P30154 | PPP2R1B | 0.77996 | anatomical structure development GO:0048856 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 7 | P0DH78 | RNF224 | 0.7633 | |
| 8 | Q8N3Z3 | GTPBP8 | 0.73994 | |
| 9 | Q9NYZ4 | SIGLEC8 | 0.73994 | cell adhesion GO:0007155 signal transduction GO:0007165 |
| 10 | P47972 | NPTX2 | 0.72821 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 |
20 40 60 80 100 AA: MLGAKPHWLPGPLHSPGLPLVLVLLALGAGWAQEGSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQ STMI: SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDD.DDD............D...............................DDDDDDDDDDDDD................................. DO_IUPRED2A: ..........................................................DDDDD...........DDDDDDDDDDDDDDDD.......... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................ CONSENSUS: ......................DDDDDDDDDDDDD................................. CONSENSUS_MOBI: .................................................................... RICH_[AG]: AAGGpGGAAlG RICH_fLPS_[G]: aGGpGGaalG
120 140 160 180 200 AA: VLVNEGGGFDRASGSFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGF STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: LIFPL STMI: DO_DISOPRED3: ..... DO_IUPRED2A: ..... DO_SPOTD: ..... CONSENSUS: ..... CONSENSUS_MOBI: .....