Q15369 ELOC_HUMAN
Gene name: ELOC
Protein name: Elongin-C
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6ZNG0 | ZNF620 | 0.89443 | |
| 2 | P40763 | STAT3 | 0.83844 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 3 | A4D2B0 | MBLAC1 | 0.82391 | |
| 4 | Q9NP72 | RAB18 | 0.81923 | anatomical structure development GO:0048856 immune system process GO:0002376 nucleocytoplasmic transport GO:0006913 ... |
| 5 | Q7L945 | ZNF627 | 0.78935 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q9UBE0 | SAE1 | 0.76822 | cellular protein modification process GO:0006464 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 7 | P52790 | HK3 | 0.75569 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | Q6B0B8 | TIGD3 | 0.72701 | |
| 9 | P31947 | SFN | 0.70711 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell death GO:0008219 ... |
| 10 | Q9P0R6 | GSKIP | 0.70322 | cell death GO:0008219 cell-cell signaling GO:0007267 cellular protein modification process GO:0006464 ... |
20 40 60 80 100 AA: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIA STMI: DO_DISOPRED3: DDDDDDDDDDDD........................................................................................ DO_IUPRED2A: .DDDDDD.........................................D.......DD.......................................... DO_SPOTD: DDDDDDDDDDDDD....................................................................................... CONSENSUS: DDDDDDDDDDDD........................................................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDD.................................................................................... RICH_[EG]: GEEktyGGcE
AA: LELLMAANFLDC STMI: DO_DISOPRED3: ............ DO_IUPRED2A: ............ DO_SPOTD: ............ CONSENSUS: ............ CONSENSUS_MOBI: ............