P62753 RS6_HUMAN

Gene name: RPS6
Protein name: 40S ribosomal protein S6

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell death GO:0008219
- cellular nitrogen compound metabolic process GO:0034641
- homeostatic process GO:0042592
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- ribosome biogenesis GO:0042254
- signal transduction GO:0007165
- translation GO:0006412
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q15388 TOMM20 0.92961 catabolic process GO:0009056
cellular component assembly GO:0022607
cellular protein modification process GO:0006464
...
2 Q92466 DDB2 0.91092 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
3 Q9HBE4 IL21 0.89909 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
4 P62847 RPS24 0.88073 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 Q5T2T1 MPP7 0.85489 cell junction organization GO:0034330
cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
6 Q8IZU8 DSEL 0.84356 biosynthetic process GO:0009058
small molecule metabolic process GO:0044281
7 P0C843 LINC00032 0.8413
8 P61587 RND3 0.83524 cell adhesion GO:0007155
cytoskeleton organization GO:0007010
signal transduction GO:0007165
9 Q5T0J7 TEX35 0.80239
10 P0DMS9 TMIGD3 0.78 biosynthetic process GO:0009058
cell population proliferation GO:0008283
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGC
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ............................................................DDDD...................DDDDDDDD...DD....
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120                 140                 160                 180                 200
AA:                      IVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTK
STMI:                                                                                                                        
DO_DISOPRED3:            ...................................DD...............................................................
DO_IUPRED2A:             .......................DDDDDDDDDDDDD...DD..DD..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ......................DDDDDDDDDDDDDDDDDD..........DD..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .......................DDDDDDDDDDDDDDDDD......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AK]:                                                                                                           AlKKqrtK
RICH_[K]:                                                                               KegKKprtKapK            KrrrialKKqrtK
RICH_[R]:                                              RRlgpkRasR                             RtkapkiqRlvtpRvlqhkRRRialkkqR  
RICH_[KR]:                                                                                                 RvlqhKRRRialKKqRtK
RICH_fLPS_[K]:                                                                                              vlqhKrrrialKKqrtK

                                          220                 240           
AA:                      KNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK
STMI:                                                                     
DO_DISOPRED3:            ......................DDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDD.D..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .....................................DDDDDDDDDDDD
RICH_[AK]:               KnKeeAAeyAK                                      
RICH_[RS]:                                             RRRlSSlRaStSkSeSS  
RICH_[K]:                KnKeeaaeyaK   KrmKeaKeKrqeqiaK                   
RICH_[R]:                               RmkeakekRqeqiakRRRlsslR           
RICH_[S]:                                                  SSlraStSkSeSS  
RICH_[KR]:               KnK           KRmKeaKeKRqeqiaKRRR                
RICH_fLPS_[K]:           KnK