Q16890 TPD53_HUMAN

Gene name: TPD52L1
Protein name: Tumor protein D53

List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- cell death GO:0008219
- cellular protein modification process GO:0006464
- mitotic cell cycle GO:0000278
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9H5Q4 TFB2M 0.64624
2 Q9UFV1 TBC1D29P 0.5981 protein transport GO:0015031
transport GO:0006810
3 Q86UQ8 NFE4 0.52668 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
4 Q2TAY7 SMU1 0.47549
5 Q9UIG5 PSORS1C1 0.47286
6 Q9BSD3 RHNO1 0.44995 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
7 Q86UT8 CENATAC 0.44578
8 Q86VF7 NRAP 0.44391 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
9 O60906 SMPD2 0.43776 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
10 Q96FX7 TRMT61A 0.42238 cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTH
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDD...D...................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD....DD.DDDDD......................................D.....DDD.DDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................DDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................DDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDD................................................................................
RICH_[T]:                                                                                                           TTTaykkTh
RICH_[HT]:                                                                                                          TTTaykkTH
RICH_MOBI_[LQ]:             QaQgLLetepLQ                                                                                     

                                          120                 140                 160                 180                 200
AA:                      ETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEE
STMI:                                                                                                                        
DO_DISOPRED3:            .................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDD..DDDDD.........................D..D.DDDDDDDDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDD...DDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDD.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AS]:                                                                                              SStAhASAqS           
RICH_[T]:                eT                                           TfksfeerveTTvTslkTkvggT                                
RICH_[TV]:                                                                    VeTTVTslkTkVggT                                
RICH_[GT]:                                                                      TTvTslkTkvGGTnpnGG                           
RICH_[HT]:               eTlsH                                                                                               

                                         
AA:                      ELQC
STMI:                        
DO_DISOPRED3:            DDDD
DO_IUPRED2A:             DDDD
DO_SPOTD:                DDD.
CONSENSUS:               DDDD
CONSENSUS_MOBI:          ....