Q9UFN0 NPS3A_HUMAN
Gene name: NIPSNAP3A
Protein name: Protein NipSnap homolog 3A
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8TDX6 | CSGALNACT1 | 0.89443 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 2 | Q14088 | RAB33A | 0.82725 | immune system process GO:0002376 protein transport GO:0015031 signal transduction GO:0007165 ... |
| 3 | Q53S33 | BOLA3 | 0.74278 | |
| 4 | Q9BWD3 | RTL8A | 0.73994 | |
| 5 | P17036 | ZNF3 | 0.725 | anatomical structure development GO:0048856 cell differentiation GO:0030154 immune system process GO:0002376 |
| 6 | Q96SQ9 | CYP2S1 | 0.72083 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 7 | Q658N2 | WSCD1 | 0.63263 | |
| 8 | Q8N2K1 | UBE2J2 | 0.62573 | catabolic process GO:0009056 cellular protein modification process GO:0006464 protein targeting GO:0006605 ... |
| 9 | P08620 | FGF4 | 0.61887 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 10 | P05177 | CYP1A2 | 0.60921 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MLVLRSALTRALASRTLAPQMCSSFATGPRQYDGIFYEFRSYYLKPSKMNEFLENFEKNAHLRTAHSELVGYWSVEFGGRMNTVFHIWKYDNFAHRTEVR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD.D......................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[AL]: LvLrsALtrALAsrtLA
120 140 160 180 200 AA: KALAKDKEWQEQFLIPNLALIDKQESEITYLVPWCKLEKPPKEGVYELATFQMKPGGPALWGDAFKRAVHAHVNLGYTKLVGVFHTEYGALNRVHVLWWN STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 AA: ESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIPTSFSPLK STMI: DO_DISOPRED3: ............................................... DO_IUPRED2A: .......DDDDD.DDD.D............................. DO_SPOTD: ...........................................DDDD CONSENSUS: ............................................... CONSENSUS_MOBI: ...............................................