Q96KJ9 COX42_HUMAN
Gene name: COX4I2
Protein name: Cytochrome c oxidase subunit 4 isoform 2, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- generation of precursor metabolites and energy GO:0006091
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6ZRY4 | RBPMS2 | 0.91244 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 2 | O96011 | PEX11B | 0.90913 | signal transduction GO:0007165 |
| 3 | Q6P575 | GUSBP11 | 0.90687 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 4 | Q9Y5Y6 | ST14 | 0.90633 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 5 | Q8N9U9 | SPANXA2-OT1 | 0.90531 | cell cycle GO:0007049 cell death GO:0008219 reproduction GO:0000003 |
| 6 | Q8IV45 | UNC5CL | 0.90378 | cellular protein modification process GO:0006464 response to stress GO:0006950 signal transduction GO:0007165 |
| 7 | Q8TDH9 | BLOC1S5 | 0.9013 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cytoskeleton-dependent intracellular transport GO:0030705 ... |
| 8 | Q96CM4 | NXNL1 | 0.89511 | homeostatic process GO:0042592 |
| 9 | P17342 | NPR3 | 0.89361 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 circulatory system process GO:0003013 ... |
| 10 | Q9HCR9 | PDE11A | 0.88564 | signal transduction GO:0007165 |
20 40 60 80 100 AA: MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSN STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... DO_IUPRED2A: .................DDDDDDDDDDDDD............................D........DDD.............................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...D................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... CONSENSUS_MOBI: ............DDDDDDDDDDDDDDDDDDDD.................................................................... RICH_[G]: GGGGrrGmhsseGttrGGG RICH_[R]: RaawslvlRkggggRR RICH_[GR]: RaawslvlRkGGGGRRG RICH_fLPS_[G]: lrkGGGGrrGmhsseGttrGGG RICH_MOBI_[G]: GGGGrrGmhsseGttrGGG RICH_fLPS_MOBI_[G]: kGGGGrrGmhsseGttrGGG
120 140 160 AA: EWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK STMI: DO_DISOPRED3: ....................................................................... DO_IUPRED2A: ....................................................................... DO_SPOTD: ....................................................................... CONSENSUS: ....................................................................... CONSENSUS_MOBI: .......................................................................