Q5SRD1 TI23B_HUMAN
Gene name: TIMM23B
Protein name: Mitochondrial import inner membrane translocase subunit Tim23B
List of terms from Generic GO subset, which this protein is a part of:
- protein targeting GO:0006605
- protein transport GO:0015031
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q7RTY9 | PRSS41 | 0.88909 | |
| 2 | Q9Y5L4 | TIMM13 | 0.88352 | membrane organization GO:0061024 nervous system process GO:0050877 protein targeting GO:0006605 ... |
| 3 | Q9H2C2 | ARV1 | 0.87824 | biosynthetic process GO:0009058 membrane organization GO:0061024 plasma membrane organization GO:0007009 ... |
| 4 | Q5T0D9 | TPRG1L | 0.80936 | cell-cell signaling GO:0007267 |
| 5 | P30154 | PPP2R1B | 0.80773 | anatomical structure development GO:0048856 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 6 | Q8NHA8 | OR1F12 | 0.79094 | signal transduction GO:0007165 |
| 7 | Q4G148 | GXYLT1 | 0.7883 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 8 | Q07627 | KRTAP1-1 | 0.78401 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 9 | Q8WW36 | ZCCHC13 | 0.78401 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 10 | Q9Y263 | PLAA | 0.78401 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGL STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. DO_IUPRED2A: DDDDDDD............................................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................... ....... CONSENSUS_MOBI: ........................................................................ ....... RICH_[AG]: GGlAGffGAGGAGyshAdlAG RICH_[G]: GGGGsGnkttGGlaGffGaGGaGyshadlaG RICH_[FG]: GGsGnkttGGlaGFFGaGGaG RICH_fLPS_[G]: GGGGsGnkttGGlaGffGaGGaG
120 140 160 180 200 AA: KETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTETGFHHGAQANFQSEIIFRFLTRFFYAKK STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ........................ ....................................................... CONSENSUS_MOBI: ........................ .......................................................
220 240 AA: KASYSQISQKNLDFTILLRLKTLRSVESKCYVIFVVDELLKNRIPQRIKCLMHNKPT STMI: DO_DISOPRED3: .......................................................DD DO_IUPRED2A: ......................................................... DO_SPOTD: .....................................................DDDD CONSENSUS: .......................................................DD CONSENSUS_MOBI: .........................................................