Q9Y5L4 TIM13_HUMAN
Gene name: TIMM13
Protein name: Mitochondrial import inner membrane translocase subunit Tim13
List of terms from Generic GO subset, which this protein is a part of:
- membrane organization GO:0061024
- nervous system process GO:0050877
- protein targeting GO:0006605
- protein transport GO:0015031
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5SRD1 | TIMM23B | 0.88352 | protein targeting GO:0006605 protein transport GO:0015031 transmembrane transport GO:0055085 ... |
| 2 | P04632 | CAPNS1 | 0.85012 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 3 | Q9Y3D2 | MSRB2 | 0.83641 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 ... |
| 4 | Q9UK05 | GDF2 | 0.83568 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q96L46 | CAPNS2 | 0.83443 | extracellular matrix organization GO:0030198 |
| 6 | Q9Y263 | PLAA | 0.83443 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 7 | Q9HBX8 | LGR6 | 0.83166 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 8 | Q8NHA8 | OR1F12 | 0.80342 | signal transduction GO:0007165 |
| 9 | Q6ZTR6 | ZNF516-DT | 0.7642 | |
| 10 | P54652 | HSPA2 | 0.73781 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
20 40 60 80 AA: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM STMI: DO_DISOPRED3: DDDDDDDDDDDDDDD.............................................................................DDD DO_IUPRED2A: ..............................................................................................D DO_SPOTD: DDDDDDDDDDDDDDDDDDD......................................................................DDDDDD CONSENSUS: DDDDDDDDDDDDDDD.............................................................................DDD CONSENSUS_MOBI: ............................................................................................... RICH_[G]: GGfGsdfGGsGsG RICH_[FG]: GGFGsdFGGsGsG RICH_fLPS_[G]: meGGfGsdfGGsGsG