Q5TA78 LCE4A_HUMAN

Gene name: LCE4A
Protein name: Late cornified envelope protein 4A

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5T7P3 LCE1B 0.87165 anatomical structure development GO:0048856
cell differentiation GO:0030154
2 Q5T751 LCE1C 0.77537 anatomical structure development GO:0048856
cell differentiation GO:0030154
3 Q5TA77 LCE3B 0.73453 anatomical structure development GO:0048856
cell differentiation GO:0030154
response to stress GO:0006950
4 Q5T7P2 LCE1A 0.71138 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
5 Q5T754 LCE1F 0.67415 anatomical structure development GO:0048856
cell differentiation GO:0030154
6 Q5T753 LCE1E 0.63673 anatomical structure development GO:0048856
cell differentiation GO:0030154
7 Q5T5A8 LCE3C 0.6174 anatomical structure development GO:0048856
cell differentiation GO:0030154
response to stress GO:0006950
8 Q05823 RNASEL 0.60219 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
9 Q5T752 LCE1D 0.5947 anatomical structure development GO:0048856
cell differentiation GO:0030154
nervous system process GO:0050877
10 Q5T5B0 LCE3E 0.58457 anatomical structure development GO:0048856
cell differentiation GO:0030154

                                           20                  40                  60                  80 
AA:                      MSCQQNQQQCQPPPKCPIPKYPPKCPSKCASSCPPPISSCCGSSSGGCGCCSSEGGGCCLSHHRHHRSHCHRPKSSNCYGSGSGQQSGGSGCCSGGGCC
STMI:                                                                                                                       
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDD......................DDDD................DDDDDDDDD..DDDDDDDDDDDDDDDDDDD.
DO_IUPRED2A:             ...................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDD......................DDDD................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.
CONSENSUS_MOBI:          .............................................................................DDDDDDDDDDDDDDDDDDDDDD
RICH_[PQ]:                  QQnQQQcQPPPkcPiPkyPPkcP                                                                         
RICH_[C]:                  CqqnqqqCqpppkCpipkyppkC                                                                          
RICH_[G]:                                                                                               GsGsGqqsGGsGccsGGG  
RICH_[P]:                           PPPkcPiPkyPPkcP                                                                         
RICH_[S]:                                                                                          SSncygSgSgqqSggSgccS     
RICH_[CG]:                                                                                    ChrpkssnCyGsGsGqqsGGsGCCsGGGC 
RICH_[CH]:                                                                                   HCHrpkssnC                     
RICH_[CP]:                 CqqnqqqCqPPPkCPiPkyPPkCP                                                                         
RICH_[CQ]:                 CQQnQQQCQpppkCpipkyppkC                                                                          
RICH_[CS]:                                                                                         SSnCygSgSgqqSggSgCCS     
RICH_[GS]:                                                                                         SSncyGSGSGqqSGGSGccSG    
RICH_[KP]:                             KcPiPKyPPK                                                                           
RICH_fLPS_[P]:                      PPPkcPiPkyPPkcP                                                                         
RICH_fLPS_[Q]:           mscQQnQQQcQpppkcpipk                                                                               
RICH_fLPS_[C]:             CqqnqqqCqpppkCpipkyppkC                                                                          
RICH_fLPS_[PQC]:           CQQnQQQCQPPPkCPiPkyPPkCP                                                                         
RICH_fLPS_[G]:                                                                                            GsGqqsGGsGccsGGG  
RICH_MOBI_[C]:                                                                                        CygsgsgqqsggsgCCsgggCC
RICH_MOBI_[G]:                                                                                          GsGsGqqsGGsGccsGGG  
RICH_MOBI_[CG]:                                                                                       CyGsGsGqqsGGsGCCsGGGCC
RICH_MOBI_[GS]:                                                                                         GSGSGqqSGGSGccSG    
RICH_fLPS_MOBI_[C]:                                                                                     gsgsgqqsggsgCCsgggCC
RICH_fLPS_MOBI_[CG]:                                                                                  CyGsGsGqqsGGsGCCsGGGCC
RICH_fLPS_MOBI_[G]:                                                                                   cyGsGsGqqsGGsGccsGGG