Q5TA77 LCE3B_HUMAN

Gene name: LCE3B
Protein name: Late cornified envelope protein 3B

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5T751 LCE1C 0.76372 anatomical structure development GO:0048856
cell differentiation GO:0030154
2 Q5T5A8 LCE3C 0.74606 anatomical structure development GO:0048856
cell differentiation GO:0030154
response to stress GO:0006950
3 Q5TA78 LCE4A 0.73453 anatomical structure development GO:0048856
cell differentiation GO:0030154
4 Q5T5B0 LCE3E 0.7342 anatomical structure development GO:0048856
cell differentiation GO:0030154
5 Q5T754 LCE1F 0.72036 anatomical structure development GO:0048856
cell differentiation GO:0030154
6 Q5T7P2 LCE1A 0.71988 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
7 Q5T753 LCE1E 0.69183 anatomical structure development GO:0048856
cell differentiation GO:0030154
8 Q9BYE3 LCE3D 0.6783 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
9 Q5T7P3 LCE1B 0.65843 anatomical structure development GO:0048856
cell differentiation GO:0030154
10 A0A1B0GTR4 SPRR5 0.62939

                                           20                  40                  60                  80     
AA:                      MSCQQNQQQCQPLPKCPSPKCPPKSSAQCLPPASSCCAPRPGCCGGPSSEGGCCLSHHRCCRSHRCRRQSSNSCDRGSGQQDGASDCGYGSGGCC
STMI:                                                                                                                   
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDD.........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ...............................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDD.........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PQ]:                  QQnQQQcQPlPkcPsPkcPP                                                                        
RICH_[C]:                  CqqnqqqCqplpkCpspkC                                                                          
RICH_[G]:                                                                                            GsGqqdGasdcGyGsGG  
RICH_[P]:                           PlPkcPsPkcPP                                                                        
RICH_[CD]:                                                                                        CDrgsgqqDgasDC        
RICH_[CG]:                                                                                        CdrGsGqqdGasdCGyGsGGCC
RICH_[CK]:                             KCpspKCppK                                                                       
RICH_[CP]:                 CqqnqqqCqPlPkCPsPkCPP                                                                        
RICH_[CQ]:                 CQQnQQQCQplpkCpspkC                                                                          
RICH_[KP]:                             KcPsPKcPPK                                                                       
RICH_fLPS_[G]:                                                                                    cdrGsGqqdGasdcGyGsGG  
RICH_MOBI_[PQ]:             QQnQQQcQPlPkcPsPkcPP                                                                        
RICH_MOBI_[C]:             CqqnqqqCqplpkCpspkCppkssaqC                                            CdrgsgqqdgasdC        
RICH_MOBI_[G]:                                                                                       GsGqqdGasdcGyGsGG  
RICH_MOBI_[P]:                      PlPkcPsPkcPP                                                                        
RICH_MOBI_[CD]:                                                                                   CDrgsgqqDgasDC        
RICH_MOBI_[CG]:                                                                                   CdrGsGqqdGasdCGyGsGGCC
RICH_MOBI_[CK]:                        KCpspKCppK                                                                       
RICH_MOBI_[CP]:                   CqPlPkCPsPkCPPkssaqC                                                                  
RICH_MOBI_[CQ]:            CQQnQQQCQplpkCpspkC                                                                          
RICH_MOBI_[KP]:                        KcPsPKcPPK                                                                       
RICH_fLPS_MOBI_[C]:                                                                                 rgsgqqdgasdCgygsggCC
RICH_fLPS_MOBI_[CG]:                                                                              CdrGsGqqdGasdCGyGsGGCC
RICH_fLPS_MOBI_[G]:                                                                               cdrGsGqqdGasdcGyGsGG