Q5TG92 CA195_HUMAN
Gene name: C1orf195
Protein name: Putative uncharacterized protein C1orf195
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A0A1B0GTQ4 | MYMX | 0.87853 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 2 | Q9BT56 | SPX | 0.87167 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 circulatory system process GO:0003013 ... |
| 3 | A8MTB9 | CEACAM18 | 0.85344 | |
| 4 | Q96NB1 | CEP20 | 0.8349 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 |
| 5 | Q5U4N7 | GDF5-AS1 | 0.82343 | |
| 6 | Q5XG85 | n/a | 0.81195 | |
| 7 | Q6QEF8 | CORO6 | 0.79413 | cytoskeleton organization GO:0007010 |
| 8 | Q8N7P7 | n/a | 0.77642 | |
| 9 | Q9H2U6 | LINC00597 | 0.76806 | |
| 10 | Q9UBV4 | WNT16 | 0.76806 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
20 40 60 80 100 AA: MPSSTLTCKPFDLKQRSSRRGPKSTASASPRSCLKPSCGKQVCLLLSVRRSQSLAHPGRDSTRVLSYQQTSSDAVSQYKHTGKVEELYGLRLSWLSQAQF STMI: DO_DISOPRED3: DDDD.................DDDDD.......................................................................... DO_IUPRED2A: ...........DDDD.DDDDDDDDDDDDDDD........................DDDDDDDDDDDD........D........................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............DDDDDDDDDD...................................... CONSENSUS: DDDD.......DDDDDDDDDDDDDDDDDDDD........................DDDDDDD...................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. RICH_[R]: RssRRgpkstasaspR RICH_MOBI_[RS]: RSSRRgpkStaSaSpRS RICH_MOBI_[R]: RssRRgpkstasaspR
120 AA: LLAQDKTAYAVKSVVLPASNHKTKGQ STMI: DO_DISOPRED3: .................DDDDDDDDD DO_IUPRED2A: ...................DDDDDDD DO_SPOTD: ................DDDDDDDDDD CONSENSUS: .................DDDDDDDDD CONSENSUS_MOBI: ..........................