Q6FI13 H2A2A_HUMAN
Gene name: H2AC18
Protein name: Histone H2A type 2-A
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96KK5 | H2AC12 | 0.88508 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 2 | Q99878 | H2AC14 | 0.87857 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 3 | Q16777 | H2AC20 | 0.86902 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 4 | O75129 | ASTN2 | 0.7835 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 5 | Q9BTM1 | H2AJ | 0.76868 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 6 | Q8IV32 | CCDC71 | 0.70306 | |
| 7 | Q7L7L0 | H2AW | 0.70239 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 8 | P0DPH9 | CXorf51B | 0.69975 | |
| 9 | Q6UWX4 | HHIPL2 | 0.69689 | |
| 10 | Q15050 | RRS1 | 0.68893 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGK STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDD.DD...................................................D.D....DD................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDD............................................................................... RICH_[AG]: GrGkqGGkArAkAksrssrA RICH_[AK]: KqggKArAKAKsrssrA RICH_[AR]: RgkqggkARAkAksRssRA RICH_[K]: KqggKaraKaK RICH_[R]: RgkqggkaRakaksRssR RICH_[GK]: GrGKqGGKaraKaK RICH_[GR]: GRGkqGGkaRakaksRssR RICH_[KR]: RgKqggKaRaKaKsRssR RICH_MOBI_[AK]: KqggKArAKAK RICH_MOBI_[K]: KqggKaraKaK RICH_MOBI_[R]: RgkqggkaRakaksRssR RICH_MOBI_[GK]: GrGKqGGKaraKaK RICH_MOBI_[GR]: GRGkqGGkaRakaksRssR RICH_MOBI_[KR]: RgKqggKaRaKaKsRssR
120 AA: VTIAQGGVLPNIQAVLLPKKTESHHKAKGK STMI: DO_DISOPRED3: ....................DDDDDDDDDD DO_IUPRED2A: ...................DDDDDDDDDDD DO_SPOTD: ..................DDDDDDDDDDDD CONSENSUS: ...................DDDDDDDDDDD CONSENSUS_MOBI: .............................. RICH_[HK]: KtesHHKaKgK